(data stored in ACNUC7421 zone)

EMBL: CP001743.PE567

CP001743.PE567       Location/Qualifiers
FT   CDS_pept        545579..546091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0576"
FT                   /product="conserved hypothetical protein"
FT                   /note="SPTR: A7VY45 Putative uncharacterized protein; COGs:
FT                   COG4712 conserved hypothetical protein; KEGG: sec:SC0333
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27349"
FT                   /protein_id="ADD27349.1"
FT                   /translation="MDRISILTQPLTTDEIEWKIISAKNGQTTLAPYIDARAVMSRLDK
FT                   AFGPFGWQVRYTPAQVGSEHGVIASITIKNPETGEWVEKQDGSGASDMEPFKGGISGAL
FT                   KRAATTWGIGRELYSYPRVVVEGEHRFIPFKVLERLKGLPKAVAEGKPLPEVIRLNTEG
FT                   ESVRKGG"
     atggacagaa tcagcatcct gacccaaccc ctcaccaccg acgagatcga gtggaagatt        60
     atctcggcca agaacggcca gaccaccctg gccccctaca tcgacgcacg agccgtcatg       120
     agccgcctgg acaaagcctt cggccccttc ggctggcagg tgcgttacac tccggctcag       180
     gtgggcagcg agcacggggt gatcgccagc attaccatca aaaacccgga aaccggggag       240
     tgggtggaga agcaggacgg ttcaggcgct tctgacatgg agcccttcaa gggaggcatc       300
     tccggcgctt tgaaaagagc cgccaccacc tggggcatcg ggcgggagct ttacagctac       360
     cccagggtgg ttgtggaggg ggagcacagg ttcatcccct tcaaggtgct ggagcggctc       420
     aagggcttgc ccaaggccgt tgcggagggt aagcctctac cggaggtcat ccggctcaac       480
     acggaggggg agagtgtgcg gaaggggggt tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page