(data stored in ACNUC7421 zone)

EMBL: CP001743.PE568

CP001743.PE568       Location/Qualifiers
FT   CDS_pept        546233..546817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27350"
FT                   /protein_id="ADD27350.1"
FT                   /translation="MIDQAHTLTLNWEGPFAWPGFESVAGLPSLPQKPGVYLQTFEYQN
FT                   GYLIYLAGITRRPVSARFKDHTRKYLNGEYNVLDIDAARRGVRKEVWHGWGYARAHREE
FT                   FEARKPEILEAVHRQLAGFCIFVADVGTGPRVLERIEAAVMNHLYRQPPPFCDIPDKGM
FT                   YLAPRRPSEDPIRAENVCRALLHGLPDFVEV"
     atgatcgacc aagcacacac cctcacgctt aattgggagg ggccctttgc ctggccggga        60
     ttcgagagtg tggctgggct gccttcactt ccccaaaaac ccggggtcta ccttcagacc       120
     ttcgaatacc agaacggcta cctgatctac ctcgccggga tcacccgtcg cccggtctcc       180
     gcccgcttca aggatcacac ccgcaaatac ctcaacggag agtacaacgt actggacatc       240
     gacgcggccc ggcgaggggt gcgtaaggag gtttggcacg gctgggggta cgcgcgggcg       300
     caccgggagg agttcgaggc gcgcaagccg gagatcctcg aggctgtaca ccgacagctg       360
     gcgggctttt gcatcttcgt tgcggacgtg ggcactggcc ctcgagtcct cgagcgcatc       420
     gaggctgcgg tcatgaacca tctgtaccgg cagccgcccc ctttctgcga cattcccgac       480
     aaaggcatgt acctggctcc ccgccgacct tcggaggacc ccatccgggc cgagaacgtt       540
     tgcagggctc ttctccacgg gctccctgat ttcgtggagg tatag                       585
//

If you have problems or comments...

PBIL Back to PBIL home page