(data stored in ACNUC7421 zone)

EMBL: CP001743.PE569

CP001743.PE569       Location/Qualifiers
FT   CDS_pept        complement(547190..549865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0579"
FT                   /product="Type III site-specific deoxyribonuclease"
FT                   /EC_number="3.1.21.5"
FT                   /note="PRIAM: Type III site-specific deoxyribonuclease;
FT                   PFAM: type III restriction protein res subunit; InterPro
FT                   IPR006935; KEGG: asu:Asuc_0674 type III restriction protein
FT                   res subunit; COGs: COG3587 Restriction endonuclease; SPTR:
FT                   A5KSS2 Type III restriction enzyme, res subunit; PFAM: Type
FT                   III restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27351"
FT                   /protein_id="ADD27351.1"
FT                   /translation="MKIKFESNQEYQLEAIQAVTGVFEGQPLSEGLYTLGMESDELYGI
FT                   AAYANGLLLSPEALLENVRRVQEANGLEPSDRLEAIEIPDSGIALNFSVEMETGTGKTY
FT                   VYLRTIYELHRLYGFKKFIVAVPSVAIREGVLSNLRLTKEHFDTLYGNVPVDYWVYDSK
FT                   QVSRLRSFATENTLQILIINIDAFNKPSNNVIFLPNDRLSGFCPIEFIRAAHPIVIVDE
FT                   PQNFESNLAKRALASLNPLCTLRYSATHRNPYNLLYRLDPVRAYDLGLVKQIEVTSVLE
FT                   EENFNVPYLKLKEVKATKSSISAKVELDVWDGSAAKRKSVTLKQGSDLYELSGGRELYR
FT                   GYVVDEIDAGFKYVSFANGVRLEEGQEQGVNADELMRAQIRETVREHLNKELAVARLPE
FT                   GQRLKVLSLFFIDRVANYRGEDAKFRRWFEEAYHELSSLPVYASLNLPPVEQVHGGYFA
FT                   EDKTGWKDTSGNTQADEEAYEKIMRDKERLLSLEEPLRFIFSHSALREGWDNPNVFQIC
FT                   TLNETRSEVKKRQEIGRGLRLPVRENGERSFDARINRLTVIANESYKDFAKALQTEIEE
FT                   ETGLDFGQERIKNSRERRTLKLKKGWELNEDFRALWERIKHHTRYRVEFDTEDLVQRAA
FT                   KAIREMPKVERPRYRIEKGRIVRLGEDLETALVRVNTEDLDFRPAVPDLLAYLQRETEL
FT                   TRGTLARILKESGRLADAKENPQQFIDLALAAIRNTLGELMVEGIKYERLEGQAYDMML
FT                   FESKELIGYLDKIVEVSNSIYDGVIFQSEVERGFAEALDKREDVKLFVKLPDWFEVDTP
FT                   LGKYRPDWAVVMVDGEQEKLYFICETKGSKDMTKLRVSERLKIESGRAHFQALEVPYVV
FT                   ETSAAELSPERVRSSFKSSE"
     atgaagatca agttcgagag caaccaggag taccagctcg aggccatcca ggcagtgacg        60
     ggggtattcg aagggcaacc cttgagcgag gggctctaca ccctgggcat ggagtccgac       120
     gaactatatg gcatcgccgc ctacgccaac gggctgctgc tcagcccaga ggccctgctg       180
     gagaacgtcc gccgggtgca ggaggccaac gggctggaac cgagcgatcg gctcgaggcc       240
     atcgaaatcc ccgatagcgg catcgcgctc aacttctcgg tagagatgga gaccgggact       300
     ggcaagacct acgtctacct ccgcaccatc tacgagctgc accgcctcta cggcttcaag       360
     aagttcatcg tcgccgtgcc cagcgtcgcc atccgggagg gggtgctctc gaatctgcgc       420
     ctcaccaaag agcatttcga caccctctac ggcaacgtgc cggtggacta ctgggtctac       480
     gactccaaac aggtctcacg gctgcgctcc ttcgctaccg agaacaccct gcaaatcctt       540
     atcatcaaca ttgatgcctt caacaaaccg agcaacaacg tgatctttct ccccaatgac       600
     cggctttcgg gcttctgccc catcgaattc atccgggcgg cgcacccgat cgtcatcgtg       660
     gacgagccgc agaacttcga gagcaacctg gcgaaacgag ccctggcgag cctgaatccc       720
     ctctgcacgc tgcgttactc agccacccac cgcaacccct acaacctgct ttaccggctc       780
     gacccggtac gggcctacga cctcgggctg gtcaagcaga tcgaggtgac gtcggtgctc       840
     gaggaggaga acttcaacgt tccctacctg aagctgaagg aagtcaaggc caccaaaagc       900
     agcatcagcg ctaaggtaga gctcgacgtt tgggacggga gtgccgccaa gcgcaaatcc       960
     gtgaccctca agcagggctc cgacctctac gagctgtcgg gggggcggga gctgtaccgg      1020
     ggctacgtgg tggacgagat cgacgcgggc ttcaagtacg tgagcttcgc caacggggtg      1080
     cgcctggagg aggggcagga acaaggagtc aacgccgatg agctgatgcg ggcgcagatc      1140
     cgagaaaccg tgcgcgaaca cctgaacaag gaactcgccg tcgcgcggct gccggagggc      1200
     cagcgcctca aggtgttgtc cctgtttttc atcgaccggg tagccaacta ccggggcgaa      1260
     gacgccaagt ttcggcgctg gttcgaggag gcctaccacg aactttcgtc actcccggtc      1320
     tacgcctcct tgaaccttcc cccggtggag caggtgcacg ggggctactt cgccgaggac      1380
     aagacaggat ggaaggacac ctcgggcaat acccaggccg acgaggaggc ctacgagaag      1440
     atcatgcgcg ataaggagcg gctgttgtcg ctggaggagc ccttgcgctt catcttcagc      1500
     cactcggcct tgcgcgaggg ctgggacaac cccaacgtgt tccagatctg cacgctcaac      1560
     gagacccgct ccgaggtcaa gaaacgccag gagatcgggc ggggcctgcg cctgccggtg      1620
     cgcgagaacg gggaacgatc gttcgacgcc cggatcaatc ggctgaccgt catcgccaac      1680
     gagagctaca aggacttcgc taaggccctg cagaccgaaa tcgaggagga gaccggcctt      1740
     gactttgggc aggagcgtat caaaaacagc cgcgagcggc gcaccctcaa gctcaagaag      1800
     ggctgggagc tcaacgagga cttccgcgcg ctttgggaac ggatcaagca ccacacccgc      1860
     taccgggtgg agttcgacac cgaggacctc gtgcagcggg ccgccaaggc catccgtgag      1920
     atgccaaagg tcgagcgccc gcgctaccgc atcgaaaagg ggcgcatcgt ccggcttggc      1980
     gaagacctcg agaccgcact cgtcagggtc aacaccgaag acctggactt ccgccccgcc      2040
     gtccctgacc tgctggccta ccttcagcgc gagaccgagc tgactcgcgg caccctggcc      2100
     cgcatcctca aggagtcggg gcggctggcg gatgccaagg agaaccccca acagttcatc      2160
     gacctagccc tagccgccat caggaacacc ctcggggagc tgatggtgga gggcatcaag      2220
     tacgaacggc tcgagggaca ggcctacgac atgatgctct tcgagagcaa ggaactcatt      2280
     ggctacctgg acaaaatcgt cgaggtgagc aattccatct acgacggggt gatcttccag      2340
     tcggaggtcg agcggggctt cgccgaagcc ctggacaagc gcgaggatgt gaagctcttc      2400
     gttaagctcc ctgactggtt cgaggtggac accccgctcg gcaagtaccg ccccgactgg      2460
     gccgtggtca tggtagatgg cgagcaggag aagctctact tcatctgcga gaccaagggc      2520
     agcaaggaca tgactaagct gcgcgtcagc gagcgcctca agatcgagag cggcagggcc      2580
     catttccagg cgctcgaggt tccttacgtc gtagaaacct ccgcggctga actgagccct      2640
     gagcgcgtcc gatcaagctt caaaagtagc gaatga                                2676
//

If you have problems or comments...

PBIL Back to PBIL home page