(data stored in ACNUC7421 zone)

EMBL: CP001743.PE570

CP001743.PE570       Location/Qualifiers
FT   CDS_pept        complement(549868..551757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0580"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="PRIAM: Site-specific DNA-methyltransferase
FT                   (adenine-specific); PFAM: DNA methylase N-4/N-6 domain
FT                   protein; InterPro IPR001091:IPR002295:IPR002941:IPR002052;
FT                   KEGG: msl:Msil_1946 site-specific DNA-methyltransferase
FT                   (adenine-specific); COGs: COG2189 Adenine specific DNA
FT                   methylase Mod; SPTR: A0ZFK1 Site-specific
FT                   DNA-methyltransferase (Adenine-specific); PFAM: DNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27352"
FT                   /protein_id="ADD27352.1"
FT                   /translation="MVPDKLLLTTPNPIEERLETLRELFPEAFTEGRLDLETFQKLLGM
FT                   KVETGRERYGLSWAGKAEAIRAVQIPSRGTLRPKRDQSVDFDTTENVIIEGDNLEVLKL
FT                   LQQAYHGKVKMIYIDPPYNTGNDFVYPDDFREGIRQYLRFTGQLSEDGVRLTTTPEEGG
FT                   RIHSRWLSMMYPRLQLARSLLRDDGVIFVSIDDHELHNLRAIMDEIFGEENFLATILWQ
FT                   KKYAPSNDTTDFSYTHDYLLSYVKSRRFNELGKAVATLKRMERTEEQNRLYKNPDNDPR
FT                   GPWMSDNYTCNKTSEQRPNLYYPIIHPKTGKEIWPSPTRVWAYSREVHERNVSENRVWW
FT                   GLNQENETPRYKRFLSEVAGVVADTWWEHTDVGHTDEAKKEFKSLFGEDADAFDTPKPV
FT                   RLLKRLLQLATEPDAGDIVLDFFAGSGTLGQAVLEMNQEDGGDRRFVLVQLPEPTPNPN
FT                   YPTISSVTRGRVQKAAERIRSGDEKSAVQLLEPDGQDLGFRAFSLDTSNFKLWDGEAED
FT                   IQGALEGLVDNLVEGRSQEDVLFELLLKAGLPLSSKIREQEIHGQKVYSVAEGQLLVCL
FT                   ERPIRAETLRAMTALEPKPLQVVCLDVAFSGNDALKTNIVLEMRDRGIRFRTA"
     atggtacccg acaagcttct cctcaccaca ccgaacccga tcgaggagcg cctcgagacc        60
     ctccgcgaac tcttccccga ggccttcaca gagggaagac tcgacctcga gaccttccag       120
     aaattgttgg ggatgaaggt ggaaacgggg cgggaacgct acgggctgtc atgggctggg       180
     aaggccgaag cgatccgcgc agtgcaaatc ccgagtaggg gaaccctgcg acctaagcgg       240
     gatcaatccg tagattttga taccaccgaa aacgtgatca tcgaggggga caacctcgag       300
     gtgcttaagc tgttacaaca ggcctaccac ggcaaggtca agatgatcta cattgacccg       360
     ccctacaata cgggcaacga ctttgtatac cccgacgatt tccgggaagg gattcggcag       420
     tacctccgct ttaccggcca gctatccgag gatggggtca ggctaaccac cacacccgaa       480
     gaaggaggac gaatccatag caggtggctg tccatgatgt accctcggct gcaactcgcc       540
     cgaagcctcc tgcgggacga cggggtgatt ttcgtcagca ttgacgacca cgagctgcac       600
     aatctccggg cgatcatgga tgagattttc ggggaggaga actttctcgc caccattctt       660
     tggcagaaaa agtatgctcc ctcgaatgac accaccgatt tttcctacac ccatgactat       720
     ctgctttctt atgtgaagtc tcgccggttc aacgagctag ggaaggccgt ggcgacgctc       780
     aaacgaatgg agcgtactga agagcagaac cggctttata aaaaccctga caatgacccc       840
     aggggaccgt ggatgtcgga taactacacc tgtaacaaaa cttccgagca gaggcccaac       900
     ctttactatc cgatcattca tcccaagacc ggcaaggaga tatggccgag cccgacacgg       960
     gtatgggcat acagtaggga agtacatgaa cgcaacgtca gtgagaatcg tgtctggtgg      1020
     gggctgaacc aagagaatga aacaccccgc tataagcgct tcctatcaga ggtcgctggc      1080
     gtggtagccg atacttggtg ggagcatacc gatgtcgggc acaccgacga agcgaagaag      1140
     gagttcaaat cgctgttcgg ggaggacgcc gacgccttcg atacgcccaa gccggtgagg      1200
     ctgctcaagc ggctgcttca gctcgctacc gagcccgatg ccggggatat cgtcctcgat      1260
     ttcttcgcgg ggtcaggcac gctggggcag gctgtgctgg agatgaacca ggaggacgga      1320
     ggtgaccgga ggttcgttct tgtccagcta cccgaaccca cccccaaccc caattacccg      1380
     accatcagca gtgtgacgcg tggccgagta caaaaagcgg cggagcgcat caggtcgggg      1440
     gacgaaaaat cagcagttca gctcctagag ccggacggcc aggatttagg cttcagggcc      1500
     tttagtttag acactagcaa cttcaagctg tgggacggcg aggccgagga cattcaaggc      1560
     gctctcgagg gcctcgtaga caacctcgtg gaggggcgca gccaggagga cgtgctcttc      1620
     gagctgttgc tcaaggccgg tctgccgctg tcctcgaaga tccgggaaca agagatccat      1680
     gggcaaaagg tgtactcggt ggcggagggg cagttgctgg tctgcctcga gcggcccatc      1740
     cgggccgaga ccttgcgggc gatgacggcc ttggagccta agccccttca ggtggtgtgc      1800
     ctggacgtgg ccttctcagg caacgacgcg ctcaagacca acatcgtcct ggagatgcgg      1860
     gaccggggca tccgctttcg cacagcctag                                       1890
//

If you have problems or comments...

PBIL Back to PBIL home page