(data stored in ACNUC7421 zone)

EMBL: CP001743.PE571

CP001743.PE571       Location/Qualifiers
FT   CDS_pept        551941..552753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0581"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0652 hypothetical protein; SPTR:
FT                   A1HR69 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27353"
FT                   /protein_id="ADD27353.1"
FT                   /translation="MNYPKAIAHKGPVGYGATLPQIFSVEGLGDCLVKFAQSDHGPKAL
FT                   ANELIGFQVADVLGLEHPECGVVEIEAEVLPDDGKLEVTSPSGDRFTFLPGLAFYSRWL
FT                   PSAQHPTPDDLNTLELANPRMLAGVVVLDLLLGNWDRTAANPNLLLERRGQRRLVVIDL
FT                   GLAFGGGLWELGNLRDTSFPPLYDPLPYGEDLDRLLRTVNPATDFSSYLGKMSELSRPR
FT                   LESIVGTIPLEWGISSREREALVDYVCTKARNLPAYLEQRLQKQEWWR"
     atgaactacc ctaaagccat cgcccacaag ggcccggtgg ggtacggggc cactctgccg        60
     cagattttca gcgtggaggg gctaggtgac tgtctggtca agttcgcgca atccgatcac       120
     ggccccaagg cccttgctaa cgagctgatt gggttccagg tggccgacgt gctgggcctg       180
     gaacaccccg agtgcggagt tgtagagatc gaggcggagg tgctgcccga cgacgggaag       240
     ctcgaggtga cgagcccctc cggagaccgc ttcaccttcc tgccaggcct ggccttctat       300
     tcacggtggc tcccctcggc gcaacacccc accccagacg atctcaacac cctcgagctg       360
     gcgaaccccc gaatgctcgc gggtgtggtg gtgctggacc tgctgctcgg gaactgggac       420
     cgcaccgcag ccaatcccaa cctcctgctc gaacggcgcg ggcagcgacg cttggtcgtg       480
     atcgacctcg gcttggcctt cggaggcggg ctgtgggagc tgggcaacct acgggatacg       540
     agcttcccgc cgctgtatga cccgctcccg tatggagagg acttggacag actcctccgg       600
     acagtcaacc ccgccacgga cttttcatcc taccttggta aaatgtcgga gttgagccgc       660
     cctcggctcg agtccatcgt ggggacaatt ccgttggagt ggggaatttc atcccgcgag       720
     cgcgaggctt tggtagacta tgtgtgcacc aaagcccgga acctccccgc ctatctcgag       780
     caacggctcc agaagcagga gtggtggcga tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page