(data stored in ACNUC7421 zone)

EMBL: CP001743.PE576

CP001743.PE576       Location/Qualifiers
FT   CDS_pept        559206..560141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0588"
FT                   /product="iron dependent repressor"
FT                   /note="InterPro IPR001367; PFAM: iron dependent repressor;
FT                   PFAM: Iron dependent repressor, N-terminal DNA binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27358"
FT                   /protein_id="ADD27358.1"
FT                   /translation="MRWQVALLSLIAALALPVVGLVTGRVVGDFFLRGDLIGAVGAAFG
FT                   VLVYALALASSYSHLRHYYRGYEAQGVRASWALALAVEVATFYMSFAYVVIHSPWAFWG
FT                   SLIGAFVVFWGNFSSMYEARVQTATLRASSSVASFPGDSRVVDKAPAASEEPVVQAQPF
FT                   RAAVDPVQERSQYEAILETLLSAEAVETKISQVRQSVRAVQTATVPQKARSEPLSEIPT
FT                   RTEERQQEPTLLLSEGDKEVLRLAAEGPIGPSGISRALGIAKSSAGDRLKKLERMGLLV
FT                   KRGSSYVPTSHAQASIEGGQALYQGAQAPH"
     atgcgctggc aagtggcttt gctctccctc atcgcggctc tggcattgcc ggtggttgga        60
     ctggtcacgg gccgggtagt gggagatttc ttcctccgtg gagacctgat cggcgcggtc       120
     ggggcggcct tcggcgtgct ggtgtacgcc ctggcgctgg cctcctccta ctcgcacctg       180
     cgccactact accggggcta tgaggcccag ggggtgcggg cctcgtgggc gctggccctc       240
     gcggtcgagg ttgcgacctt ttatatgagc tttgcgtatg tggtcattca ctccccgtgg       300
     gccttctggg gcagcctgat cggggccttc gtggtgttct ggggcaactt ctccagcatg       360
     tatgaggccc gggtccaaac ggccacactg cgcgcttcgt caagcgtggc gtcttttccc       420
     ggcgatagcc gggtggttga caaagcccct gcagcgagcg aggagcctgt agtccaggca       480
     caaccctttc gcgctgcggt ggatccggtg caggagcgtt cgcagtacga agccatcctc       540
     gagacgctcc tctcagcgga ggctgtggaa accaagatca gccaggtgag acagtcggtg       600
     cgggcagtcc aaacggccac ggttccacag aaagccagga gcgaacccct gtcggagatt       660
     ccgacccgca cggaagaacg tcaacaggaa cccaccctgc tcctctccga gggggataag       720
     gaagtactcc gtctggcggc ggaggggcca atcggcccct cggggatcag ccgggcgctg       780
     gggatcgcca agagttccgc cggagaccga cttaagaagc tggagcgcat ggggcttctg       840
     gtgaagcgcg gctcgagcta cgttcccacg agtcacgccc aagcatccat tgagggagga       900
     caggcgctgt accagggggc gcaggcgccc cactga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page