(data stored in ACNUC7421 zone)

EMBL: CP001743.PE577

CP001743.PE577       Location/Qualifiers
FT   CDS_pept        complement(560363..562354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0589"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; plasmid stabilization
FT                   system; SPTR: A0Z9T6 Putative DNA helicase; InterPro
FT                   IPR007712:IPR000212:IPR014016; COGs: COG0210 Superfamily I
FT                   DNA and RNA helicase; KEGG: vei:Veis_4174 UvrD/REP
FT                   helicase; PFAM: UvrD/REP helicase; Plasmid stabilisation
FT                   system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27359"
FT                   /protein_id="ADD27359.1"
FT                   /translation="MQRHTIFTITALRELQAVPARERDALLSDIDLLARDPRSGRLNLS
FT                   PLHKYPGFHRLKVGNWRVFCRLDEYVEIHAVRRRSEDTYSLPFNPRTLNTPSELTTPHP
FT                   DDWDEEDEKLAAGGPPKEQVFPLRPEQLEGWGVPRLYFPQFLSCTSDDDLLALDSVVPA
FT                   EWVVHVISMLYQPGLDQTQSEAQYVVHSRQELEDYLSGRLSDLLLRLDPEQIHASEWRL
FT                   EGPTLVRGGPGTGKTVVALYRALAYAQHRPGSRILFATYTTTLAHYAEQLLSRLIEERG
FT                   LDAEVEVSWVDRLVRQNLKAASWKIAGDSELLDAVRVVLGELRDPFLQGLGPRYLRDEF
FT                   HDVIQAWDLDHREYLSFARHGRQLPLYPEEREKVWVAYDRWRRLLDQRRLLSWNRARSA
FT                   ARASAQPNYDAVIVDEAQDLPPVALRFLLRLVKHPKGFYLTADANQSLYQQGFSFKAVD
FT                   QALDMRGRSLLLRRNYRSTRPIHAALAALARHPSLESEDLPEPAHRDGPRPLLVGIAHD
FT                   KEAGTLRDLIYRLCRQLRVPLSGVSILCPSEARAREVVDILNRLDVPAAWSKGEDLELD
FT                   QPAVKALTLHSAKGLEFPVVVVLDVNQGTLPRQAAVPAEEVEAYEARDRRLFYVACSRA
FT                   MQALVVAYDPRWPSPFVRELPPELWEQR"
     atgcagcggc acacgatctt cactatcacc gctctgaggg agttgcaagc ggttcccgct        60
     cgtgagcgag atgccctgtt gagcgacatc gacctactgg caagggatcc acgctcgggg       120
     cggctcaacc tgagtccact acataagtac cctggttttc atcgattgaa agtgggtaac       180
     tggcgggtct tctgccgcct ggatgagtac gtggagatcc acgcggttcg ccggcgtagc       240
     gaggacacct acagtctgcc ctttaacccc cgcacgctga acacgcccag cgagctcact       300
     acgccacacc ccgatgattg ggacgaggag gacgaaaagc tcgccgcagg aggcccgccg       360
     aaggagcagg tcttcccgct acgccccgag cagctcgagg gctggggcgt accacgactt       420
     tacttccctc agttcttgag ctgcactagc gacgacgact tgcttgcact cgatagcgtg       480
     gtgcctgccg agtgggttgt gcacgtgatc agcatgctat atcagcctgg cctggatcaa       540
     acgcagtccg aggcgcagta cgtggtgcac tcgcggcagg aactggagga ctacctcagc       600
     ggccgcctca gcgacctact gctccgcctt gatcccgagc aaattcacgc ctcggagtgg       660
     cggctggagg gtccaaccct ggtgcgcggc ggtcccggca ccggaaagac cgttgtggcc       720
     ctgtaccggg ccctggccta cgcccagcac cggcccggct cgcggatcct gttcgccacc       780
     tacaccacca ccctcgccca ctacgccgag cagctgctct cacgcctgat cgaagagcgg       840
     ggcctggacg ctgaggtcga ggttagctgg gtggataggc tagtgcggca gaacctgaag       900
     gccgcctcct ggaaaattgc tggcgactca gagttgctcg acgccgtgcg ggtcgtgctg       960
     ggcgagctac gggatccgtt cctgcagggt ttgggcccgc gctatctgcg cgatgagttc      1020
     catgacgtaa ttcaggcctg ggatctcgat cacagggagt acctgagctt cgcacgtcat      1080
     gggcggcagc tcccgttata ccccgaggag cgagaaaagg tgtgggtagc ctacgaccgc      1140
     tggcgcaggt tgctcgatca gcgccggctg ctgagttgga accgggcccg gtcggcagca      1200
     cgagccagtg cacaaccgaa ctacgatgcg gtaatagttg acgaggcaca ggatctcccg      1260
     cccgtcgccc tgcgcttcct actgcgcctc gtcaagcacc cgaagggctt ctatctcacc      1320
     gccgacgcta accagagcct ctaccagcag gggttttcct ttaaggcggt agatcaagcg      1380
     ctcgacatga ggggccggag ccttctgctg cggcgcaatt accgctcgac acggcctatt      1440
     catgcagcgc tggcagcgct ggcccgccat ccctcactgg agtcggagga tctgcccgaa      1500
     ccagcccacc gtgatggacc caggccgctg ctggtgggga ttgcccacga caaggaggcc      1560
     ggcacgctcc gcgatctgat ctaccgcctg tgcagacagc tgcgagtgcc tctgagtggg      1620
     gtaagtatcc tttgcccgag cgaagcccgc gcgcgtgagg tggttgacat actcaaccgg      1680
     ttggatgtac ccgccgcctg gtcaaaggga gaggatctcg agttggatca accagcggtc      1740
     aaggcgctga cgctgcactc ggccaagggc ctggagttcc cggtggtcgt ggtgctcgac      1800
     gtcaaccagg gcacgctccc ccgccaggcc gcggtgcccg cggaggaggt ggaggcctac      1860
     gaggcccgtg accgccggct gttctacgtc gcctgctcgc gggccatgca agccctggtg      1920
     gtcgcctacg acccccgctg gccgagcccc ttcgtgcgtg agctgccgcc ggagctctgg      1980
     gagcagcgat ag                                                          1992
//

If you have problems or comments...

PBIL Back to PBIL home page