(data stored in ACNUC7421 zone)

EMBL: CP001743.PE579

CP001743.PE579       Location/Qualifiers
FT   CDS_pept        complement(563294..566650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0591"
FT                   /product="ATP-dependent DNA helicase, RecQ family"
FT                   /note="COGs: COG0514 Superfamily II DNA helicase;
FT                   InterProIPR001650:IPR011545:IPR014001:IPR014021:IPR 004589;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family; KEGG:
FT                   slo:Shew_3474 ATP-dependent DNA helicase RecQ; SMART:
FT                   DEAD-like helicase ; helicase domain protein; SPTR: A0Z0Y2
FT                   Putative uncharacterized protein; PFAM: DEAD/DEAH box
FT                   helicase domain protein; helicase domain protein; PFAM:
FT                   DEAD/DEAH box helicase; Helicase conserved C-terminal
FT                   domain; TIGRFAM: ATP-dependent DNA helicase, RecQ family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27361"
FT                   /protein_id="ADD27361.1"
FT                   /translation="MELWPAEAYSRFSLLDPMAPERQGAFGRLLLPFFERAMPDSAALD
FT                   APKPGPEHWRLGGAPVTVDALEALQASSRWTLVQAKRQGIAVRSGDPAWGRWLVLGPAA
FT                   LRLWSAAWLARLGTGESGELRVRIRGDQPLPVLALLDSLELLEVVRRLYGLKQRLPRVR
FT                   LEADGLGEASQRALRAYLGDPEGQLRRLLLAEVEFGSVSEVDVLIDDPQDPLLLADWQP
FT                   DEVLEAARGLIQDPAGIDPGYHIVDPAPEVLDHLFSRFFRHHRLRPEQAEAVRRVLAGE
FT                   SLLVLLPTGYGKSAIYQLAALIQPGTALVVSPLVSLILDQVDHLYRDGITGVGFMSGRK
FT                   HAAGTAEATLEHLRNGRYRLFYIAPERLDLANFRRELGELIRGHRFSLIAVDEAHCVSE
FT                   WGHDFRTSYLHLKGLRQYIEQQGVTERVPMLALTATASPVVRADILRLLGISPDSVVQS
FT                   RSSDRPELSYSVHVVDGRQGFAGRLQALDEVLTRVAPTVLGAGSEGLLERDSRGRHRHG
FT                   AVVFAPFANAHSRAFFASNAAAVAEHLRRNRVLPEGAVGIHSNSAPGHCPRCGSTRYYS
FT                   DYGRYRCAEADCGFVGKRDDFTSPSDWDEHLLEVQAQFLDNRLPVLVSTKGFGMGIDKP
FT                   NIRLVVHYVMSGSLEGYYQEAGRAGRDRAHAHVALVTVPPDPTCAEQHLGDRAIFGLGA
FT                   DDPLPLPCLERDRRGFPTLRCPFGLKELCDVGQQAYFINQNFPGARDELTQLTEAYNRA
FT                   LTGRLLVESAGAGDSKPVEKALSRLRVLEVLHTYTRQRSHAYRATLNQDWTWARGVAAL
FT                   ADYVRGYGEATGTPDAVLIEVEELARSEGNQAEFVQRAGKILIEALYTTIRAMRLAGLR
FT                   NLYHYAALPAGSCRRVYLRRAFELRLPQDYSCGFCDTCVPDMKFGRERALVPEEAARER
FT                   ILAEGLENVLTGYNLTALRTYAREVVEAGFVGAVRGRAEYLLEQRPNDLAVLFLAALCA
FT                   GLEGERATAKVLTERALDVMLRARMGLTNQLAFVLALGEWVPSLADDLAGDPQGVLGRN
FT                   HPRLTLLETLRQLDPARAAHVERAWALEGLVKVAERLSKLLPAEVLKAFTTAVEHVTPP
FT                   HRDRGIGGMNG"
     ttggaactgt ggcctgccga agcctacagc cgcttctctc ttcttgaccc aatggctcca        60
     gagcgccagg gtgctttcgg caggcttttg ctcccctttt tcgagcgagc gatgcccgat       120
     tccgcggcgc tagatgcacc aaagcccggc ccagagcact ggcgcctggg cggcgcgccg       180
     gttaccgtcg atgctctaga ggccctacaa gcctcatcgc gctggaccct ggttcaggca       240
     aaacggcaag ggatagccgt gcggagcggt gatccggcct ggggacgctg gctggtgctg       300
     ggaccggcag cgctgcggct gtggtcggct gcctggctgg cccggctggg cacaggggaa       360
     tcgggcgagt tgcgggtgcg gattcgcggc gaccagcctc taccggtgct cgcactcctg       420
     gacagcctgg aattgctgga agtggtgcgg cggctttacg gccttaagca gcgattgccg       480
     cgagtccggc tggaggccga tgggctggga gaagcgtcgc agcgggcact ccgggcctac       540
     ctgggcgacc ccgagggcca gcttagacgc ttgctgctgg cggaggtgga gttcggatcc       600
     gtgagtgagg tggacgtgct catcgacgac ccccaagacc cactcttgct ggcggattgg       660
     cagccggacg aggttctgga ggccgctcgg gggttaattc aggatccggc gggcattgac       720
     ccgggctacc acatcgtcga tccggcgccg gaggtgctcg accacctgtt cagccggttt       780
     ttccgccacc accgcctgag accggagcag gccgaggccg tgcggcgggt gctcgctggc       840
     gagagtctgc tggtgctgct gccaacgggc tacggcaaat cagcaattta tcagctagct       900
     gccctgatcc agccgggcac cgccctggtg gtctccccgc tggtctcact cattctcgac       960
     caggtcgacc acctctaccg cgacgggatc accggggtgg gcttcatgag tggacgcaag      1020
     cacgctgccg ggaccgcaga ggccacgttg gagcaccttc gcaatggccg ctaccgtctt      1080
     ttctacatcg ctcctgagcg cctcgacctg gccaacttcc ggcgggagct gggggagctc      1140
     atccggggcc accgcttctc tctaatagcc gttgacgagg cccactgtgt gtcagagtgg      1200
     gggcacgatt tccgcacctc ttacctccat ctcaagggtc tacgtcagta catagagcag      1260
     caaggagtga ccgagcgtgt accgatgctg gccctcaccg ccactgcctc accggtggtg      1320
     cgtgcagata tcctgcgtct gctgggcatc agtccagaca gtgtggtgca gagccgcagt      1380
     agcgaccggc ccgagcttag ctacagcgtc cacgtcgtcg atggccgcca gggcttcgct      1440
     ggacgactgc aagcactgga cgaggtgctg acccgggtcg cgcctaccgt gttgggggca      1500
     gggagcgagg ggttgctcga gcgcgactcc cgcggccgcc accgccacgg cgcagtggtt      1560
     ttcgccccct ttgccaacgc tcacagccgt gcctttttcg ccagcaacgc agcggcggtg      1620
     gcagagcacc tccggcgcaa cagggtgctg ccagagggag cggtaggcat ccactccaac      1680
     tctgccccgg gccactgccc gcgctgtggc tctacccgtt actacagcga ctacggccgt      1740
     tatcgctgcg ctgaggcgga ctgcgggttc gttgggaaaa gggacgactt caccagcccc      1800
     agcgattggg acgagcatct gctagaggtt caggcccaat tcctcgacaa ccgcctgccg      1860
     gtgctggtct cgaccaaagg cttcgggatg ggtatcgaca agccgaacat acgcctggtg      1920
     gtgcactacg tgatgtcagg cagcctggag ggctactacc aggaggctgg ccgggctgga      1980
     cgtgaccgcg cgcacgccca cgttgcgctg gtcacagttc ctccggatcc cacctgcgcc      2040
     gagcagcacc tgggcgaccg ggctatcttc ggactgggag cggacgaccc cctaccgctc      2100
     ccctgtctgg aacgcgacag gcggggtttc ccaacgttac ggtgtccctt cggcttgaag      2160
     gagctttgcg acgtgggcca gcaggcttat ttcatcaacc agaatttccc cggtgcccgg      2220
     gatgaactaa cccaacttac cgaggcctac aacagggcgc tgaccgggag gctgctggtg      2280
     gagtcggccg gggctggtga cagcaaaccg gtggagaagg ccctctcccg cctgcgagtg      2340
     ttggaggtgc ttcacaccta tacccgccag aggagccacg cctaccgagc gacgctcaat      2400
     caggactgga cctgggctcg cggcgtcgcc gctctggctg actacgtgcg cggctacggc      2460
     gaagccacgg gcaccccgga cgcggtgctg atcgaagtcg aagaactggc ccgctccgag      2520
     ggaaaccagg ccgagttcgt gcagcgagcc gggaagatcc tcatcgaggc gctctatacc      2580
     acgatccggg ccatgcggct agcagggctg cgcaacctct accactatgc agccctgccg      2640
     gcgggcagtt gtcggcgcgt atatcttcgg cgggccttcg agctacgcct gccacaggac      2700
     tatagctgcg gtttctgtga cacctgcgta ccggacatga aattcgggcg tgagcgagct      2760
     ctggttcccg aggaggcagc gcgcgagcgg atcctggccg agggtcttga gaacgtgctt      2820
     acaggctaca acctcacggc gctgaggaca tacgcccgcg aagtggtcga ggcgggattc      2880
     gtgggcgctg tgcgcggccg ggcggagtat ctgctcgagc aacgacccaa cgacctggcg      2940
     gtgctgtttc tggctgccct gtgcgcgggc ctcgagggcg agagggccac cgccaaggtg      3000
     ctgaccgagc gtgctctgga cgtgatgctg cgcgcacgga tgggcttgac gaaccagctg      3060
     gccttcgtgc tagccctggg agagtgggtg ccgagcctcg ctgacgacct agcaggggat      3120
     ccccaggggg ttctgggacg caaccacccc cgcctcaccc tgcttgagac cctccggcag      3180
     cttgaccctg ctcgtgcagc gcacgttgaa cgtgcctggg cgcttgaggg actggtgaag      3240
     gttgccgagc gcctgagcaa gttgctgcct gcagaagtgc ttaaggcttt caccactgct      3300
     gttgagcacg tcacgccccc acatagagat agaggtatag gaggaatgaa tggctga         3357
//

If you have problems or comments...

PBIL Back to PBIL home page