(data stored in ACNUC7421 zone)

EMBL: CP001743.PE580

CP001743.PE580       Location/Qualifiers
FT   CDS_pept        complement(566836..571212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0592"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; InterPro
FT                   IPR001650:IPR011545:IPR014001:IPR014021; KEGG: bsu:BSU22220
FT                   hypothetical protein; COGs: COG1205 Distinct helicase
FT                   family with a unique C-terminal domain including a
FT                   metal-binding cysteine cluster; SPTR: A2SR89 DEAD/DEAH box
FT                   helicase domain protein; PFAM: Domain of unknown function
FT                   (DUF1998); DEAD/DEAH box helicase; Helicase conserved
FT                   C-terminal domain; haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27362"
FT                   /protein_id="ADD27362.1"
FT                   /translation="MDKGREDLPETPMHQWQYLIYDEKAQGFLNPISGQRVPSEGAFPH
FT                   DTVVVWDGTTAFPVWLVPTDALPPGLPNTWCTAVAQARTVAELQRAVVSLAPAQAEEVL
FT                   RTLPDELIHAWTGEAWPRTLAELLYQMSLDRYCQRLRERGVELCQIPAISDEPLSLDQA
FT                   EVLNPRPQLRPGQVVPLDALGLDEHLARALAAAGAKEGLFTHQALSLEFLRATRHEPFD
FT                   LVITTPTASGKTLAFAPGILEDLLQRNNTALFIYPLRALTTDQYDKLTRICKGLPLKLR
FT                   PFFGSISLDELLQEGLPHVVVATPDKLNHYLDRPELAGFFSQVRYIVLDEAHAYRGYFG
FT                   INMALFLRRLMALVHSDVRLVLSTATLDNTADFVRRLTGRNRFRVVGASGAPVHARFFY
FT                   RGVAKNVPSLIHVVQRERRKGIAFVESRAETRRLAETYRRQRGTQVHPLFSGHRDYANV
FT                   LHQLRQGNESMFVFSTTTLEAGIDIGDLQHVAILGFPGSRNSFKQMAGRAGRSGPAHVV
FT                   FIPRTGRLGVAADEYYSRLDNLKRLVEAQADPVYINPANPVLLRQHLQRMRWEAHRMGL
FT                   RGGEELLEQLLSPAAVPETVRKELKRKFAPLLTQPLARVEAPPLRSMPGLTYLVIRLGE
FT                   GAPIQGIGELTLEAETTPEWMLGELRQEAAHREWALGLVFPHQGRYYRSIDWTRARVTR
FT                   NQRTEEAVLVWVEDVTDSLMDPEEYNRAYYGAKQVDRPDFKQVKHYHSPWLVVYPRLEE
FT                   VEARTAIGSVIAEAGRGRVRVGLELVVKRLTKTVQFRCPSLRSTRGIRGIHGVEEWVVE
FT                   DCDGRRVLLDPLEKRELLKSGSVVVPESARDGEEPIQGRGYVLQSYSKRQARVSTHAFN
FT                   FVLPGTCSCGEETEPHYGWKTGFENVPDTWKNHPVFSPLAREYETDLGQIRFSDGSTAA
FT                   YWALSNALAKAIPDVLETDLSDIGFALQAPRHELVFTAYDAVEGGIGVATQLPAKLPEI
FT                   LAEARRLLELSLRCDCQGQGCFGCILPLRELRLPQDIPATSGAVEAPPAEQARLLLEET
FT                   RPYKPEPNTTAAAHLLRNLLEPPSRPDTNTTLLPKLTEYPVFRRLIFVLDSLLLDSSSV
FT                   SKAQRLREDPDLLVENLRPIPRVMEILEELLGGRVEVVLVSNNSMRYVETALKRHFPAS
FT                   VAARLLGSAVASANKPSTGRLQPLIEDLNPQEVLLVGDRLEDVLTARRLGIVSALATWS
FT                   AADAAHALNAGPDLIFSAPEDLLYALGDYRAYLHPLEQEGVPAEVIAAPLRLSRAGRVW
FT                   SVLGRYLPERPRSRRANDLLSNARYQILDFKRSGKRVRAVADYLVRRFPDLPVAYVPSR
FT                   QPVQAGLDALAEELEARGHPVLRVLQWQRVPPLRQHDAGGEAERRANVAGALRVADPAA
FT                   VRGLRLLLLDDLISSGQTLIEADRALVEAGARPEALALAYSLWERDRAAGPEEEMA"
     atggataaag gacgtgagga tctaccggag acccctatgc atcagtggca gtaccttatc        60
     tacgatgaaa aagctcaggg cttccttaac ccaatctcag gccaacgcgt gccatctgag       120
     ggagcctttc cacatgacac ggtagtcgtt tgggacggca ctacagcctt tccggtgtgg       180
     ttggttccca ctgatgcact cccacctggg ctgccaaaca cctggtgcac ggcggttgca       240
     caagcacgga cggtagcaga gttgcaacgt gcggtggtat cccttgctcc ggcccaggcc       300
     gaggaagtac tgcgcaccct accggacgaa ctcatccacg cctggactgg tgaggcgtgg       360
     cctcgaaccc tggccgagtt gttgtaccag atgagtctcg atcgctactg ccagcggctg       420
     agagagcggg gggtcgaatt gtgccaaata cctgcgatct cggatgagcc gctgagtctc       480
     gaccaggccg aggtgctcaa cccccggcca cagctaaggc ccggccaggt cgtccctctt       540
     gatgctctcg gcctcgacga gcatctggcc cgggcgctgg cagctgcagg cgctaaggaa       600
     ggtctcttca ctcaccaggc actgtcactg gaattcctgc gcgccacccg tcacgagcca       660
     ttcgacctcg tgattaccac ccccactgcc tcaggcaaga ctctggcctt cgccccgggc       720
     atcctcgaag acctgttgca gcggaataac actgcgctgt ttatctaccc gctgcgtgca       780
     ctcactaccg accaatacga caagctcacg cggatatgta agggactgcc actcaagctg       840
     cgccccttct tcggtagcat cagcctcgat gaactactcc aggaagggct tccccacgtt       900
     gtagtggcta cccccgataa gctcaaccac tacctcgacc gcccggaact ggccgggttc       960
     tttagccagg ttcgttacat cgtccttgat gaagcccacg cttaccgcgg ctacttcggc      1020
     ataaatatgg ctctgtttct gcgacgactc atggcgctgg tgcacagcga cgtgcggttg      1080
     gtactgtcaa ctgccaccct tgacaacacc gccgacttcg tgcgtcgcct gaccgggcgt      1140
     aatcgcttcc gcgtggtggg tgcgtcaggg gcgccggttc acgcacgctt tttctaccgt      1200
     ggtgtcgcaa aaaacgtgcc cagcctcatc catgttgtcc agcgtgagag gcgcaaggga      1260
     atcgccttcg tggaaagccg ggctgagacc cggcgtctgg cagagaccta ccgccgccag      1320
     cgtggcacgc aagtacaccc tctcttcagt ggccaccggg actacgccaa cgtcctgcat      1380
     cagttgcgcc agggcaatga gtcgatgttc gtcttttcta cgaccacact agaggctggt      1440
     attgacattg gtgacctcca gcacgtcgct atcctggggt tccctggtag ccgcaacagc      1500
     ttcaagcaaa tggctggacg ggccgggcgc tcagggccgg cgcacgtggt cttcatccca      1560
     cgtactggcc gtctcggtgt agcggcagac gagtactatt ctcgccttga taacctgaaa      1620
     cggcttgtag aagcccaggc cgatccggta tatatcaacc ccgccaaccc ggttttgcta      1680
     cggcagcacc tacagcgcat gcgttgggag gcacatcgca tggggctgcg aggtggcgag      1740
     gaactgctcg agcaactcct gagtccagca gccgtgcccg agacggtgag gaaggagctc      1800
     aaacggaagt tcgccccgct acttacacag ccgcttgcaa gggtcgaagc gccgccgttg      1860
     cggtcgatgc cgggcctgac gtacctggtg atcaggctag gcgagggggc tccgatccag      1920
     ggtatcggcg agctaacgct ggaggcggag acgaccccgg agtggatgct tggggagttg      1980
     cggcaggagg cggctcatcg ggagtgggcg ctgggcctgg tgttcccaca tcagggccgc      2040
     tactaccgca gcatcgattg gacgcgcgcc cgcgttaccc ggaaccagcg cactgaggag      2100
     gccgtgctgg tatgggtcga ggacgtcacc gacagcctga tggatcctga ggagtacaac      2160
     cgggcgtact acggtgccaa gcaggtggat cggcccgact tcaagcaggt gaagcactac      2220
     cacagtccgt ggcttgtcgt ctaccctcgg ctcgaggagg tcgaagcccg cacagctata      2280
     ggttcggtta tcgcagaagc aggacggggg cgggtacggg taggcctgga gttggttgtc      2340
     aagcgcctca ctaagaccgt gcaattccgc tgcccgtcac tgcgaagcac tcggggaatc      2400
     agagggatcc atggtgttga ggagtgggta gtggaagact gcgacgggcg gagagtgctc      2460
     ttggatccgc tggagaagcg agaactgctc aagagcggaa gcgtggtggt gccggagtcc      2520
     gcacgagacg gagaggagcc gatacagggg cgagggtacg tcctgcagag ttattccaaa      2580
     cgccaggcca gggtgagtac tcatgccttc aactttgtgc tacctggtac ctgctcgtgc      2640
     ggggaggaga cggagccaca ctatggctgg aaaactgggt tcgagaacgt cccggacacc      2700
     tggaagaatc acccggtgtt ctcgcctctc gctcgcgaat acgagaccga tctcggccag      2760
     atccgcttca gcgacggctc aacagcggcg tactgggcct tgagcaacgc actggccaag      2820
     gccattcccg acgtactcga aaccgacctc tccgacatag gcttcgcctt gcaggccccg      2880
     cggcacgagc tggtattcac cgcttacgac gctgttgagg gcggcatcgg ggttgccacc      2940
     cagttgcctg ccaagctgcc ggagatcctg gcggaggccc gacggctgct ggagctgagc      3000
     ctgcgctgcg actgccaggg tcaggggtgc ttcggctgca tcttgccttt gcgcgaactc      3060
     aggcttcccc aggacatccc tgcgaccagc ggcgcggtag aagcgccccc ggccgagcag      3120
     gcgcggctgc ttctggagga gacccgtccg tacaagcccg agcccaatac cacggctgca      3180
     gcacacctgc tacgcaacct gctcgagcca ccctcccggc cagacaccaa caccaccctt      3240
     ctgcccaaac tcacagaata ccctgtcttt cggcgactga ttttcgttct cgacagcctg      3300
     ctgctcgaca gctccagcgt ctccaaagcg cagcgtctac gtgaagatcc cgacctgctg      3360
     gtcgaaaatt tgcgcccgat cccccgcgtc atggagattt tggaggaact cctgggcggc      3420
     cgggtcgagg tggtgctggt cagcaacaac tcaatgcgct acgtcgagac tgccttaaag      3480
     cggcacttcc ccgcgagtgt ggcagcgagg ctcctgggta gcgctgtggc gtcggccaac      3540
     aaaccaagca ccggtcggct gcaaccgctg attgaggatc tgaacccgca agaggtgctt      3600
     ctggtaggag accggctaga ggacgtgctg acagcacgac ggctggggat cgtctccgct      3660
     ctggcgacct ggagtgcagc ggacgcagcc cacgccctca acgcagggcc agatcttatc      3720
     ttctctgctc cagaagacct cctctacgca ctgggcgact accgggctta cctgcacccc      3780
     ctggagcagg agggcgtccc agccgaagta atcgcggccc cgctgcgact gagccgggcc      3840
     gggcgggttt ggagtgtcct cgggcgctac ctccctgagc ggcccaggag caggcgagcc      3900
     aacgacctcc taagcaatgc acgttaccag atcctcgatt tcaagcgctc tggcaagcgt      3960
     gttcgtgcag ttgcagatta cctcgtgcgg cgttttccgg atttaccggt ggcctatgtg      4020
     ccttcacgac agcccgtcca ggccggattg gatgccctgg ccgaggaact cgaagcccgt      4080
     ggacatcccg tgctgagggt gctgcagtgg caacgggtgc ctcccctccg ccagcatgac      4140
     gctggagggg aggcggagcg gcgcgccaac gtggccggag ccttgcgggt ggccgatccc      4200
     gccgccgtgc gcgggctacg cttacttctg ctcgatgatc tgatcagcag cggccagacc      4260
     ctcatcgagg ccgatcgtgc cctggtcgag gcgggggcca gacccgaggc gctggctctg      4320
     gcctacagcc tgtgggagcg tgaccgggcg gccggcccgg aggaggagat ggcgtga         4377
//

If you have problems or comments...

PBIL Back to PBIL home page