(data stored in ACNUC7421 zone)

EMBL: CP001743.PE582

CP001743.PE582       Location/Qualifiers
FT   CDS_pept        572045..572680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0594"
FT                   /product="Excalibur domain protein"
FT                   /note="PFAM: Excalibur domain protein; nuclease (SNase
FT                   domain protein); SMART: nuclease (SNase domain protein);
FT                   InterPro IPR006021:IPR008613; KEGG: sal:Sala_0134
FT                   excalibur; COGs: COG1525 Micrococcal nuclease
FT                   (thermonuclease) homologs; SPTR: A6FRL0 Succinoglycan
FT                   biosynthesis protein; PFAM: Staphylococcal nuclease
FT                   homologue; Excalibur calcium-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27364"
FT                   /protein_id="ADD27364.1"
FT                   /translation="MLRLLTCFLFALSLALAQDTVAGRASVIDADSLEIQGSRIRLWGV
FT                   DAVESSQTCLDARGRVWPCGRRATFALSDFLGQRTVYCVRKGTDRYRRMLAVCSVGGVE
FT                   INRWLVEQGWALSYTRYEGAVYLDSQKRAKAARRGIWQGSFQEPWTYRANPANPPSAGA
FT                   PRPSKPSSDIYYRNCAEARAAGAAPIYRGQPGYRPGLDRNGDGVACER"
     atgttgcgac ttttgacctg ctttttgttt gctctaagct tggccctggc ccaggacacc        60
     gtggcagggc gtgccagcgt gatagacgcc gattctttgg aaatccaggg gagccgcatc       120
     cgcctgtggg gggtggacgc cgtggagagc agccagacct gtttggacgc tcgtgggagg       180
     gtatggccct gtggacggcg ggctactttt gctttgtcgg actttctggg acagaggacg       240
     gtgtattgcg ttcggaaggg taccgatcgg tatagacgga tgttagcggt gtgcagcgtg       300
     gggggcgtag agatcaaccg ctggttggtg gagcagggat gggcactttc ttatactcgg       360
     tatgaaggcg cggtctatct tgacagccaa aaacgggcca aagccgcccg gcgaggcatc       420
     tggcagggga gttttcaaga accctggaca taccgcgcca atcctgccaa cccacccagc       480
     gccggggcgc cgcgaccctc gaagccctcc tcggacatct actaccgcaa ctgcgctgaa       540
     gctagggcgg caggtgctgc gccgatctat cggggtcagc cgggatatcg gccaggattg       600
     gatcggaatg gcgacggggt ggcgtgcgaa cgctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page