(data stored in ACNUC7421 zone)

EMBL: CP001743.PE592

CP001743.PE592       Location/Qualifiers
FT   CDS_pept        complement(585207..586181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0607"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Ketopantoate reductase ApbA/PanE domain protein; Alcohol
FT                   dehydrogenase zinc-binding domain protein; SPTR: A8MA90
FT                   Alcohol dehydrogenase GroES domain protein; InterPro
FT                   IPR013332:IPR013154:IPR013149; COGs: COG1063 Threonine
FT                   dehydrogenase and related Zn-dependent dehydrogenase; KEGG:
FT                   sil:SPO0596 sorbitol dehydrogenase, putative; PFAM:
FT                   Zinc-binding dehydrogenase; Alcohol dehydrogenase
FT                   GroES-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27374"
FT                   /protein_id="ADD27374.1"
FT                   /translation="MQAWVLEDYGRLSVHHRETPEGAGVLLQVAACGICGSDLSVYKGA
FT                   PAMRARWKPPLVLGHEIAGIVQEGPPDWLGQAVAVNPLVACGQCPACWEGLSNLCAHRT
FT                   NIGFHYWGGFAEQIRVPLSQLHRLPAGVPLWKGALAEPLAVALRAVELAGPVLGRPVLV
FT                   LGGGAIGTLAAWLLAQAGARVTVSERNPLRAAWLEGLGFIAEVVPTPSGQYDRVLETVG
FT                   AQSTLALAVNAARPGGSVVLVGLSDLEAPLPLQRTVLQEIRIQGSYVFTQAEFARATAL
FT                   LAHLPDTLAVRRPFAMAQTSFEELLAGRLAEAKVVLLHGGCNA"
     atgcaagcat gggttctaga ggattacgga cgactcagcg tgcaccaccg cgagaccccg        60
     gaaggagcgg gggtgctctt gcaggtcgcg gcctgcggca tctgcggcag cgacctgagc       120
     gtatacaagg gggccccggc catgcgggcc cgctggaaac cacccctggt gctggggcac       180
     gagattgccg gtatcgtgca ggagggcccc ccggactggc tgggccaggc ggtagcggtc       240
     aacccgctgg tggcgtgcgg ccagtgcccg gcctgctggg aagggctgag caacctgtgc       300
     gcccatcgta ccaacatcgg ctttcactac tggggcggtt tcgccgagca gatccgggtg       360
     cccctatccc agctccaccg gctgcccgcc ggggtaccgc tgtggaaagg ggccctggcc       420
     gagccgctgg cggtagcgtt gcgggccgtg gagctggccg ggccggtgct gggccggccg       480
     gtgctggtgc tgggcggggg ggccatcggc accctggcgg cctggctgct ggcccaggcc       540
     ggggcgcggg taacggtcag cgagcgcaac ccgctgcgcg cggcctggct cgaggggctg       600
     ggctttatcg ccgaggtggt gccgaccccc agcggacagt acgaccgggt gctcgagacc       660
     gtaggggccc agagcaccct ggccctggcc gtgaacgccg cccggccggg gggtagcgtg       720
     gtgctggtgg gtttgagcga cctcgaggcc cccctcccct tgcagcgcac agtcttgcag       780
     gagattcgta tccagggctc gtatgtgttc acccaggccg agtttgcccg ggccaccgcg       840
     ctgctggctc atctgccgga taccctggcc gtccggcggc cttttgccat ggcccagacc       900
     agcttcgaag agctgctggc cggtcggctg gccgaggcca aggtggtatt gctgcatgga       960
     ggatgcaatg cgtag                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page