(data stored in ACNUC7421 zone)

EMBL: CP001743.PE593

CP001743.PE593       Location/Qualifiers
FT   CDS_pept        complement(586191..587654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0608"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; SPTR: A3K879 Putative uncharacterized
FT                   protein; InterPro IPR002823; COGs: COG3333 conserved
FT                   hypothetical protein; KEGG: csa:Csal_0071 protein of
FT                   unknown function DUF112, transmembrane; PFAM: Integral
FT                   membrane protein DUF112"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27375"
FT                   /protein_id="ADD27375.1"
FT                   /translation="MSFFSLESFLAMMLGALYGALFGSLPGLTATLAISLFIPIAIFLD
FT                   PTVAFSAIIGITATAIFAGDIGATAMRIPGTPASAAYTEEIHQIGKERSPAFALGISAL
FT                   SSALGSLVGVVILIGGSLGLAQVAKQFSSFEYFWLVLLGIVSGVFASPSMAKGLIAFGV
FT                   GMLIATIGYDPALGTPRFNFGNPNLLGGISFIVALIAFFGVAEVINNIYSYKKGHQPPA
FT                   SPNQNRSVAQEFFGAGGRLVWKERRLLLRSSLLGTFIGFLPGAGSDLAAWISSNFTRLR
FT                   RGSKEQVTLSGASSNNAAVAGTWIPALSLGIPGDTLTAIVLGMFLTMGITPGPDLFAKN
FT                   LGFVVQLYMAFILASLLMMPLVGYLGAALISTLLRIPMRLLLGAVMGLCLVGTYAINRN
FT                   PFDLYLLVVLGLLGLLMQRGGFPVGQLILGMVLGPLLEQYLMMSLIKTQWDLTAFFSRP
FT                   VAVVLAVCNLLLIVGMLWLRGQRARPNNP"
     atgagttttt ttagcctcga gtccttcctc gccatgatgc tgggagccct gtacggcgcc        60
     ttgtttggct cgcttccggg acttaccgcc accctggcca tcagcctctt catccccatc       120
     gccatctttt tagaccccac ggtagctttt tcagccatca tcggcattac cgccaccgcc       180
     atcttcgccg gggatattgg ggctaccgcc atgcgcatcc ccggtacccc ggcctcggcg       240
     gcctacaccg aggaaattca ccagattggc aaggagcgct cccccgcttt tgccctgggc       300
     atctcggccc tcagctcggc cctgggcagc ctggtggggg tggtcattct gattgggggc       360
     tcgctgggcc tggcccaggt ggccaagcag ttctcctcct tcgagtactt ctggctggtg       420
     ctcctgggca ttgtgagcgg cgtgtttgcc tccccttcca tggccaaggg gttaattgcc       480
     tttggggtgg gcatgctcat cgccaccatc ggctacgacc ccgccctggg caccccccgc       540
     ttcaacttcg gcaaccccaa cctgctggga gggatttcct tcatcgtcgc cctcatcgcc       600
     ttctttggcg tggccgaggt gatcaacaac atctatagct ataagaaagg ccaccagcca       660
     ccggccagtc ccaaccagaa tcgctcggtg gcccaggagt tctttggtgc agggggccgg       720
     ctggtctgga aggaacgccg gctcctgttg cgctcgagcc tgctgggcac ttttatcggt       780
     ttcctgccgg gggccggctc cgacctggcg gcctggatca gcagcaactt cacccggctg       840
     cgccggggca gcaaagaaca ggtcaccctc agcggggcct cctccaacaa cgccgccgtg       900
     gccggcacct ggattccggc cctttcgctg ggcatccccg gcgacaccct gacggccatt       960
     gtgctgggca tgttcctcac catgggcatt acccccggcc ccgacctgtt cgccaaaaac      1020
     ctgggctttg tggtgcagtt gtacatggcc tttatcctgg ccagcctgct catgatgccc      1080
     ctggtgggct acctgggggc ggccctgatc agcaccctgc tgcgcattcc catgcgcctg      1140
     ctgctggggg cggtgatggg tttgtgcctg gtgggcacct acgccatcaa ccgcaacccc      1200
     ttcgacctgt acctgctggt ggtgctgggc ctgctggggc tcttgatgca gcggggcggc      1260
     ttcccggtgg gtcagctcat tctgggcatg gtgctgggac ccctgctgga gcagtacctg      1320
     atgatgagcc tgatcaagac ccagtgggat ctgaccgcgt ttttcagccg gcccgtggcc      1380
     gtggtgctgg cggtatgcaa cctgttgttg attgtgggca tgctctggct gcgcgggcag      1440
     cgggccaggc ccaacaaccc gtga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page