(data stored in ACNUC7421 zone)

EMBL: CP001743.PE595

CP001743.PE595       Location/Qualifiers
FT   CDS_pept        complement(588246..589199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0610"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4284 hypothetical protein; COGs:
FT                   COG3181 conserved hypothetical protein; PFAM: conserved
FT                   hypothetical protein; SPTR: A3JUR5 Putative uncharacterized
FT                   protein; InterPro IPR005064; PFAM: Bordetella uptake gene
FT                   (bug) product"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27377"
FT                   /protein_id="ADD27377.1"
FT                   /translation="MKRVFGILAVVAVLALTLVALGQRYPVRPITLIVPWSPGGSTDLT
FT                   ARSLAPVLGNILGQPVQVVNRTGGGGAIGHAAIAQGDPSGYTIGIITLEVVLPAWVNQT
FT                   KINADAFTPIALLVLNPVAIVVRKDAPWKTAQEFIADIKANPGKYKASGTARAGSYDYA
FT                   RLGFLKKLGLKDAALPWVPAQGAAAALQELISGGINVAFVSIGEASALVKAGEARYLAF
FT                   MTDRRFPAFPDVPTLKELGVDWTFASFLMAAAPKHTLPSVARQLDQAFAKAVQDPEFVR
FT                   FMNNANLVINHLNFDQTKAFLAERNRAMAELADELK"
     atgaagcgag tttttggcat tctggcggtt gtggccgtac tggcgctcac cctggtggca        60
     ctggggcaac gctaccctgt ccggcccatt accctgatcg tgccctggtc acccggcggc       120
     agcaccgacc ttaccgcccg ttccctggcc ccggtgctgg gcaacatcct gggccagccg       180
     gtacaggtgg tcaaccgcac cggcgggggt ggggccatcg gccacgccgc catcgcccag       240
     ggcgacccca gcggttacac cattggcatc atcaccctgg aggtggtgct accggcctgg       300
     gtcaaccaga ccaaaatcaa cgccgatgcc tttacgccca tcgcgctcct ggtgctgaac       360
     cccgtggcca tcgtggtgcg caaagacgcc ccctggaaaa ccgcccagga gttcatcgcc       420
     gatatcaagg ccaaccccgg caagtacaag gcctccggca ccgcccgcgc cggctcctac       480
     gactatgccc ggctgggctt cctcaaaaag cttggcctga aagacgcggc cctgccctgg       540
     gtgcccgcac agggtgcggc cgccgctttg caagagctga tttcgggggg catcaacgtg       600
     gcctttgtct cgatcggcga agccagcgcg ctggttaaag ccggtgaggc ccgctacctg       660
     gccttcatga ccgaccggcg cttcccggcc ttccccgacg tgcccaccct gaaagagctg       720
     ggcgtggact ggacctttgc ctctttcctg atggccgcgg cccccaagca caccctgccc       780
     tcggtggccc gccagctcga ccaggccttt gccaaggccg tgcaagaccc ggagtttgtg       840
     cgcttcatga acaacgccaa cctggtcatc aaccacctga acttcgacca gaccaaagcc       900
     ttcctggccg agcgcaaccg ggccatggct gagctggccg atgagttgaa gtag             954
//

If you have problems or comments...

PBIL Back to PBIL home page