(data stored in ACNUC7421 zone)

EMBL: CP001743.PE596

CP001743.PE596       Location/Qualifiers
FT   CDS_pept        589345..590013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0611"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; InterPro
FT                   IPR000524:IPR011711; KEGG: bbr:BB3957 putative
FT                   transcriptional regulator; COGs: COG1802 Transcriptional
FT                   regulators; SPTR: A6BG57 Putative uncharacterized protein;
FT                   PFAM: FCD domain; Bacterial regulatory proteins, gntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27378"
FT                   /protein_id="ADD27378.1"
FT                   /translation="MVQPSDVEELPLRERAYLHIKRLILNEELPPNSFLSERSLAQQLG
FT                   MSKTPVRLAIARLENEGFVRVSPQQGIVVLALSFEEVLEHIDFRLALESFVVKRLAGNL
FT                   SRSQARVLQEHIQEQQALAQHPQTQTEQLVLADMAFHRRLATTLGNRQIVQALERQQDM
FT                   LYRVAHRVYQKHPSRREQSIAEHQRLLQFLVEGEQAEALGLIEQHISRIKSLLISAAGG
FT                   "
     atggttcaac ccagtgatgt ggaggaactg cccctacggg agcgggccta cctgcacatc        60
     aagcgcctga ttctcaacga ggagttaccg cccaacagct ttttatcgga gcggagcctg       120
     gcccagcagc ttggcatgag caaaaccccg gtgcggctgg ctatcgcccg cctcgagaac       180
     gagggttttg tgcgggtctc gccccagcag ggcattgtgg tgctggccct gagctttgag       240
     gaggtgctcg agcacatcga ttttcgcctg gccctggaaa gctttgtggt caagcgcctg       300
     gccggcaacc tgagccgcag ccaggccagg gtgctgcagg agcatattca agagcagcag       360
     gccctggccc agcaccccca gacccagacc gagcaactgg tgctggccga tatggcgttc       420
     caccgccggc tcgccactac cctgggcaac cgtcagattg tgcaggccct cgagcgccag       480
     caagacatgc tgtaccgggt ggcccaccgt gtgtaccaga aacacccctc ccggcgtgag       540
     cagagcatag ccgaacacca acgcctgctg cagtttctgg tcgagggtga gcaggccgag       600
     gccctgggtt tgatcgaaca gcacatcagt cgcatcaagt ctttgttgat cagcgccgct       660
     gggggctaa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page