(data stored in ACNUC7421 zone)

EMBL: CP001743.PE597

CP001743.PE597       Location/Qualifiers
FT   CDS_pept        complement(590040..590534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0612"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; InterPro IPR000086; KEGG:
FT                   mxa:MXAN_4891 hydrolase, NUDIX family; SPTR: A2VMT1
FT                   Putative uncharacterized protein; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27379"
FT                   /protein_id="ADD27379.1"
FT                   /translation="MVGGSRPQALPQSRRRVTSAGGVVLRERPGGKGLEVLLIAIKDGR
FT                   VWSLPKGQVEPGERYPQTAVREVREETGIEARVLAPLGSIRYHFTVKDDGVQTTVTKEV
FT                   HHFLMGYVGGTPRPQKEEVDGVAWFPVREALKRLSHQNERNAVLKALACWDTQAPMSAQ
FT                   P"
     atggtggggg gctcgaggcc ccaagcgctg ccgcaatccc gccgccgggt gacctcggcg        60
     gggggggtgg tgttgcgcga gcggcctggg gggaagggcc tggaggtgct cctcatcgcc       120
     atcaaagacg gacgggtctg gagcctgccc aagggccagg tagagccagg cgagcgttat       180
     ccacaaaccg ccgtccgcga ggtgcgtgaa gagactggca tcgaggccag ggtactggcc       240
     cccctgggca gcatccgcta tcacttcacg gtcaaagacg acggggtaca aaccaccgtc       300
     actaaggaag ttcatcactt cttgatgggc tacgtgggtg gcacaccccg gccccaaaaa       360
     gaagaggtgg acggggtggc ctggttccct gtgcgcgagg cccttaagcg gctttcgcat       420
     caaaacgagc gaaacgccgt tctcaaagcc ctcgcctgct gggacaccca agcacccatg       480
     agcgctcagc cataa                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page