(data stored in ACNUC7421 zone)

EMBL: CP001743.PE598

CP001743.PE598       Location/Qualifiers
FT   CDS_pept        complement(592418..593560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0613"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; CBS domain containing protein;
FT                   SMART: CBS domain containing protein; InterPro
FT                   IPR000644:IPR008915; KEGG: afw:Anae109_3134 peptidase M50;
FT                   COGs: COG1994 Zn-dependent protease; SPTR: Q3IUS4 Probable
FT                   metalloprotease/ CBS domain protein; PFAM: CBS domain pair;
FT                   Peptidase family M50"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27380"
FT                   /protein_id="ADD27380.1"
FT                   /translation="MFAKTIRLPLQLLGIPVSLDLSFLIVLPLLAFLIGSQLPLYLRLL
FT                   QIEASPDWLQGPMPYVLGLLAALGLFLSVLLHELGHALTARAYGVQTREITLWLLGGVA
FT                   QLEQIPRTRGAEAVIAIAGPIVSLLLSGLFALLRGLAPPGATDGQFLLGYLSFINLSLA
FT                   LFNLLPALPLDGGRILRSLLALYRPYLEATRTAVAVSKVMAFALGLLGLLIGNLFMLLI
FT                   AFFVFMAASAEGEQTVLSRTLEGLWVRDLMTREVSTVPPSLTVAELLEKMMLERHVGYP
FT                   VVEEGRLLGLISLEDLHGASPQTRVLERMRPPLQVNQDTEALAALQRMAEQGFSRLLVT
FT                   DEQGHLIGILSKTDLLRALQLRAAQMSLSDHPKNHIPGRA"
     atgttcgcca aaaccatccg cctgcctttg cagctcctgg gcatcccggt ctcgctcgac        60
     ctgagctttc tgattgtgct gccccttctg gcctttctga tcggcagcca gcttccgctc       120
     tacctgcggc tgctgcagat cgaggcatcg cccgactggc tccaaggccc catgccctat       180
     gtgctgggcc tgctggccgc cttgggtctg ttcctgagcg tgctgctcca cgagctgggc       240
     catgccctca cggcgcgggc ctatggcgta caaacccgcg agattaccct gtggctcctg       300
     gggggggtgg cccagctcga gcaaatcccc cgcacccgcg gggccgaggc cgtcatcgcc       360
     atcgccggcc ccatcgtgag cctgctgctt tcagggctgt ttgcgctttt gcgcggactg       420
     gcacccccag gcgcaaccga tgggcagttt ctgctgggct acttgagttt catcaacctg       480
     agcctggccc tgttcaacct gctaccagcc ctgccgctcg acggcgggcg catcctgcgc       540
     agcctgctgg ccctttacag accctacctc gaggccaccc gcaccgccgt cgcggtgagc       600
     aaagtgatgg cctttgccct gggcctgctg ggcctgctca tcggcaacct cttcatgctc       660
     ctgatcgctt ttttcgtctt tatggcggcc agcgccgagg gtgagcaaac cgtgctcagc       720
     cgcaccctcg agggcctctg ggtgcgcgac ctgatgaccc gcgaggtaag caccgtgccc       780
     cccagcctga ccgtggccga gctcctggag aagatgatgc tcgagcggca cgtgggctac       840
     ccggtggtgg aggaggggcg gctcctgggc ctgatcagcc tggaagacct gcacggggcc       900
     tcgccgcaga cccgggtgct cgagcggatg cgccccccct tacaggtaaa ccaagacacc       960
     gaagccctcg ccgccctaca acgcatggct gaacaggggt tctcgaggct cctggttacc      1020
     gacgagcagg ggcacttaat cggcattcta agcaaaaccg acctgctgcg agccctgcag      1080
     ctccgcgccg cccagatgag cttgtccgac catcccaaga accacatacc gggtagggct      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page