(data stored in ACNUC7421 zone)

EMBL: CP001743.PE599

CP001743.PE599       Location/Qualifiers
FT   CDS_pept        593653..594453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0614"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; SPTR: A0Z9P4 Putative
FT                   uncharacterized protein; InterPro IPR000878:IPR008189;
FT                   COGs: COG0313 methyltransferase; KEGG: mxa:MXAN_3552
FT                   tetrapyrrole methylase family protein; PFAM: Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases; TIGRFAM: conserved
FT                   hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27381"
FT                   /protein_id="ADD27381.1"
FT                   /translation="MRLSLVPTPIGNLEDITLRALRVLREVEVVACEDTRRTGILLKHF
FT                   GISKPMLRLDQHTVGQARRLLEGYEWVAYVTDAGTPGISDPGAELVALALKEGWQLEVL
FT                   PGPTALIPALVASGLPTARFAFEGFLPQKRSERRARLAQVAGRTVVLYEAPHRLRETLQ
FT                   DLLQIYGPEHPVAVARELSKLHEEIWRGRLADALEHFKEPRGEFVLVLGPKAEPTAGLE
FT                   QEAEAVLEHLKAQGLKGKALVKALTEAGLPRNRAYELAHKPDTP"
     atgcgcttga gtctggtacc cacccccatc ggcaacctcg aggacatcac cctgcgggcc        60
     ttgcgggtgc tcagggaagt cgaggtggtg gcctgtgagg atacccggcg caccggcatt       120
     ctgctcaaac actttggcat ctccaagccg atgctgcgcc tcgaccagca caccgtgggc       180
     caggcccggc ggcttttgga ggggtacgaa tgggtggcct acgtgaccga tgccggcacc       240
     cccggcatct ccgaccccgg cgccgaactg gtggccttgg ccctaaaaga aggctggcag       300
     ctcgaggtgc tgcccggccc caccgcccta atcccggctt tggtggcctc gggcctgcca       360
     accgctcgct tcgccttcga ggggttcctg ccccagaagc gctcggaacg gcgggcccgc       420
     ctggcgcagg tggcaggccg taccgtggtg ctctacgagg ccccccaccg tctgcgtgag       480
     accctgcagg atctgctaca aatctacggc cccgagcacc cagtggcggt ggcgcgggag       540
     ctttccaagc tgcacgagga aatttggcgg ggccggctgg ccgacgcgct ggaacacttc       600
     aaagaacccc ggggtgagtt tgtgctggtg ttgggcccca aagcggagcc tacagcaggt       660
     ctcgagcaag aagcagaagc agtgctcgag cacctcaaag cccagggcct gaaaggcaag       720
     gcgctggtca aagccctgac cgaggccggg cttccccgca accgggccta cgaacttgcc       780
     cataagccgg atacaccgta g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page