(data stored in ACNUC7421 zone)

EMBL: CP001743.PE60

CP001743.PE60        Location/Qualifiers
FT   CDS_pept        52054..53451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0061"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="SPTR: A0ZHS2 Two-component response regulator; KEGG:
FT                   mag:amb1211 response regulator; COGs: COG2206 HD-GYP
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; InterPro
FT                   IPR006674:IPR003607:IPR006675; PFAM: HD domain; GAF domain;
FT                   TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26842"
FT                   /protein_id="ADD26842.1"
FT                   /translation="MFLEIKDTLVPRGWGLGWAAIETRAPIWLDQAHLDQRAYGQFRHP
FT                   PEAYSEIVIPLLNSQGQPLGVLISARNGERAYLERDVRLLQIIGNIAANTLERVRANES
FT                   LEAEIAEKTALLELSQMLGGNDAALLPAAMEKIRQMGHADAIALGVQEPDGYHLRWLTG
FT                   HLGAEAKEFLQKPLPLEHPLVNLIPIEKAFRVGDTAAHPLLKPYARVGIRGLYLRTVVH
FT                   EPELKVVLALMRLEPSPGWGPAEDRLLEGAAQILGALLLRLERTRQLETAYEGALRAIG
FT                   LALEARDRETAGHTDRVAALVEQLGRALGLSEAELRDLRWGAYLHDVGKLALSDAILLK
FT                   PDKLTPEEFCTMRTHTHLGDDLVRNLPFVPLAARQIVRHHHERWDGRGYPDGLAGEDIP
FT                   LAARIFAVCDVFDALCSHRPYKTALSPEQAAQELWRSAQSGHLDQNLVKVFLETQGLEA
FT                   ATSQAAD"
     atgttcctgg agatcaagga caccctggtg cccaggggat ggggcctggg ctgggcggcc        60
     atcgagaccc gcgcgcccat ctggctggat caggcccacc tcgatcagcg ggcctacgga       120
     cagttcaggc accccccaga ggcttactcg gagattgtaa tccccctgct caactcccag       180
     ggccagcccc tgggggtgct gatctccgcg cgcaacggcg agcgggctta cctcgagcgt       240
     gacgtgcgcc tgctgcaaat catcggcaac atcgcagcca acaccctgga gcgcgtgcgg       300
     gccaacgaga gcctcgaggc cgaaatcgcc gaaaaaaccg ccctgctcga actctcacag       360
     atgctggggg gcaacgatgc ggccttgttg cctgcggcga tggagaaaat tcgccagatg       420
     ggtcacgccg acgcgatcgc cttgggggtg caggagccgg atggatacca cctgcgctgg       480
     ctgacgggcc atctgggggc cgaggccaag gagtttttgc agaagcccct gcccctcgag       540
     caccctttgg tcaacctaat cccgatagaa aaggcatttc gggttggcga taccgccgca       600
     caccctttgc tgaagccgta tgccagggtg ggtatacgcg gcctgtacct gcgcacggtg       660
     gttcatgaac ccgagctgaa ggtggtcctg gccctgatgc ggctggagcc cagcccgggc       720
     tggggcccgg cggaggatcg gctgctggag ggggctgccc agattttggg ggccttgctc       780
     ctgcgcctgg agcgcacccg gcagctcgag accgcctacg aaggggcttt gcgagccatc       840
     ggcctggccc tggaggcgcg ggatcgcgag accgccgggc acaccgaccg ggttgcggcc       900
     ctggtcgagc agctaggccg ggcgctgggc ctgagtgagg ccgagctgcg cgacctgcgc       960
     tggggggcct acctgcacga tgtgggcaag cttgctctct ccgatgccat cctgctcaag      1020
     cccgataagc taacccctga ggagttttgc accatgcgaa cccataccca tctgggggac      1080
     gacctggtgc gcaacctgcc ctttgtaccc ctggcggcgc gccagattgt gcggcaccac      1140
     cacgagcgct gggacgggcg gggctacccc gatggcctgg ccggggaaga tatccccttg      1200
     gcagcccgca tttttgctgt ctgcgatgtt ttcgacgccc tttgctccca ccggccttac      1260
     aaaaccgccc tatcgccgga gcaagccgcc caggagcttt ggcgcagcgc ccagagcggg      1320
     cacctcgacc aaaatttggt gaaggtattc ctcgaaacac agggcctcga ggctgccacc      1380
     tcgcaggctg ccgactga                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page