(data stored in ACNUC7421 zone)

EMBL: CP001743.PE602

CP001743.PE602       Location/Qualifiers
FT   CDS_pept        596140..596772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0617"
FT                   /product="ribonuclease H-related protein"
FT                   /note="SPTR: A7AHD9 Putative uncharacterized protein; KEGG:
FT                   bha:BH0863 ribonuclease H-related protein; COGs: COG3341
FT                   double-stranded RNA/RNA-DNA hybrid binding protein;
FT                   InterPro IPR002156"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27384"
FT                   /protein_id="ADD27384.1"
FT                   /translation="MARAAKNQSKHYVVWKGRKTGIFSSWPEAEAQVKGFAGAEYKAFD
FT                   TLSEAREAFSGRYQDYLGPKATQNRLLEVPPPITPSYCVDAACSGNPGLLEYRCVETAS
FT                   GKEIFHRGPFAQGTNNVGEFLAIVEALRLCKEKGYTWPIYSDSINAIAWVKAKKARTNL
FT                   VRTQQNAELFERISQAEAWLRSHTYPNPILKWQTDSWGENPADFGRK"
     atggctcgag cggcgaagaa tcaaagcaag cattacgtgg tctggaaggg ccgaaagacc        60
     ggtatattct cctcctggcc cgaagccgag gcgcaggtca agggttttgc gggagccgag       120
     tacaaggcct tcgataccct gagcgaagcc agagaggcct tttctgggag ataccaggac       180
     tacctgggcc caaaagccac gcagaaccgc ctcctggaag ttcccccacc gattaccccc       240
     agctactgcg tggacgcagc ttgcagcggc aatccggggc tgctggagta ccgctgtgta       300
     gagaccgctt cgggcaagga gatttttcac cggggaccct ttgctcaggg caccaacaac       360
     gtgggcgagt ttttggcgat tgtcgaggcc ctgaggcttt gcaaagaaaa gggctacacc       420
     tggcccatct actccgactc gattaacgcg attgcctggg tcaaggccaa aaaagcccgc       480
     accaacctgg tgcgcaccca gcaaaacgcc gagctgttcg agcgcatatc ccaggccgag       540
     gcctggctac gctcccatac ctaccctaac ccgatcctca agtggcagac cgatagctgg       600
     ggggagaacc cggcggattt cgggcggaaa taa                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page