(data stored in ACNUC7421 zone)

EMBL: CP001743.PE603

CP001743.PE603       Location/Qualifiers
FT   CDS_pept        complement(596780..597265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0618"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mll9669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27385"
FT                   /protein_id="ADD27385.1"
FT                   /translation="MLSWLDLVALLVLSAALGVGIRQGVAFTLAVVPALLLYILLTAWA
FT                   GSLLPIAALPVLALALSLGMAYVRHFIPINPLSPVLEGIIGGLGGLAWGLFLAAVIWVG
FT                   FPSEFVASTGALRYPSEQISSGVKDGIVSSAFARPLFDWAAGSPLFKTALIPHIRHP"
     atgcttagct ggctcgactt agtggccctt ctagtccttt cggctgccct cggcgtaggc        60
     attcgccagg gggttgcttt tacactggcg gtagtacccg ctttgctact ctacatattg       120
     ctcacagcct gggctggatc cctgctgccg atcgcagccc tgccggtgct ggccctggcc       180
     ttgagcctgg gtatggccta tgtgcggcat ttcattccga ttaatcccct cagcccggtt       240
     ctcgagggca tcattggcgg ccttgggggg ttggcctggg ggctgttctt agccgctgta       300
     atctgggtgg gcttccccag cgaatttgtg gcctccaccg gcgctctgcg ctacccttcc       360
     gagcaaattt ccagcggggt caaagatggc atcgtcagca gcgcttttgc ccgccccttg       420
     ttcgactggg cggcgggcag ccccctattc aaaacagcct taatcccgca catccgccac       480
     ccctaa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page