(data stored in ACNUC7421 zone)

EMBL: CP001743.PE604

CP001743.PE604       Location/Qualifiers
FT   CDS_pept        597693..598835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0619"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.35"
FT                   /EC_number="2.3.1.1"
FT                   /note="TIGRFAM: arginine biosynthesis bifunctional protein
FT                   ArgJ; PRIAM: Amino-acid N-acetyltransferase; PFAM: arginine
FT                   biosynthesis protein ArgJ; InterPro IPR002813; KEGG:
FT                   afw:Anae109_0632 arginine biosynthesis bifunctional protein
FT                   ArgJ; COGs: COG1364 N-acetylglutamate synthase
FT                   (N-acetylornithine aminotransferase); SPTR: P96137
FT                   Glutamate N-acetyltransferase; PFAM: ArgJ family; TIGRFAM:
FT                   glutamate N-acetyltransferase/amino-acid acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27386"
FT                   /protein_id="ADD27386.1"
FT                   /translation="MRLPIGFRAGATQAGIKPSGKPDLALLVSGTPCSWAFVGTLNKAA
FT                   APCVARGRQLLAAGQGLQAIVVNAGNANCATGEQGIWADARMAELAAAQLQLAPETVLT
FT                   ASTGVIGQPLPVEKIEAALPQIRLGLEIDPFMEAIMTTDLVPKMAEATLSSGARVVGVC
FT                   KGSGMIAPNMATMLAYIVSDAAVSQEELRRGWQGVVDKSFNQVTVDTDTSTNDMAVLMT
FT                   NGAAGPVDLAEFWQAVERVCVELARKLARDGEGATKLLTVKVTGAKSDVEARKAALSVA
FT                   ASPLWKSAVYGNDPNWGRVMMALGKAGVALEPDKVRITLQGIPLYAGKVLEFDRAQASQ
FT                   AMQAEEVLVEADLGLGEGQGTAWGCDLTEGYVRINALYTT"
     atgcgacttc cgattggttt tcgcgccggt gcaacccagg ccggcatcaa accctccggc        60
     aagcctgacc tggccctttt ggtctcggga acgccctgta gctgggcttt tgtgggaacc       120
     ctgaacaaag ccgctgcacc ttgcgtggct cgaggccgcc aactgctggc tgccggccag       180
     ggtctgcaag ccatcgtggt caatgccggc aatgccaact gtgccacggg tgagcagggc       240
     atctgggccg atgcgcgcat ggccgaactg gcggcggcgc agctacagct tgcacccgag       300
     acggtgctga ccgcctctac cggggtgatt gggcagccct tgccggtgga aaaaatcgag       360
     gctgccctgc cccagattcg gctgggactg gaaatagacc ccttcatgga agccatcatg       420
     accaccgacc tggtgcccaa gatggccgag gccaccctct cgagcggggc gcgggtggtg       480
     ggggtttgca aggggagcgg catgattgcc cccaacatgg ccaccatgct ggcttatatc       540
     gtctcggacg cggcggtttc ccaggaagag ctgcgccggg gctggcaggg cgtggtggat       600
     aaaagcttca accaggtgac ggtggacacc gacacctcca ccaacgacat ggccgttctg       660
     atgaccaacg gcgcggcggg gccggtggat ttggccgagt tctggcaggc ggtggagcgg       720
     gtttgtgtgg agctggcccg caagctggcc cgcgatggcg aaggggccac caagctgctg       780
     accgtaaagg ttaccggggc caaaagcgac gtggaggccc gcaaggccgc cctctcggta       840
     gcggccagcc ctttatggaa aagcgccgtc tacggcaacg accccaactg gggccgcgtc       900
     atgatggcgc tgggcaaggc gggggtggcg ctcgagcccg acaaagtgcg cattaccctg       960
     cagggcattc ccctctatgc cgggaaggtg ctcgagttcg accgggccca ggccagccag      1020
     gccatgcaag ccgaagaagt gctggtcgag gccgacctgg ggctggggga ggggcaggga      1080
     acggcctggg gatgcgacct caccgagggc tacgtgcgaa ttaatgcgct ctataccacc      1140
     taa                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page