(data stored in ACNUC7421 zone)

EMBL: CP001743.PE605

CP001743.PE605       Location/Qualifiers
FT   CDS_pept        598890..599351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0620"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_2879 major facilitator superfamily
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27387"
FT                   /protein_id="ADD27387.1"
FT                   /translation="MKRLAPLVVLFALLFGSLGKAQSDGFGIYSGFPTWIGVQYQVSSF
FT                   RLGAGLAFAGLGAGADYIVLEQAIPAAPGFDLSWYAGAGASVGFWTVLSNTGIYIFPHG
FT                   LVGIEYAFPAQPFSVYGELQVGFGIGTGALSGVIGGVDFNARAGLIFRP"
     atgaagcgtt tggcaccctt ggttgtgttg tttgcgttgc tgtttggctc tctcggcaag        60
     gcccagtcgg atggttttgg tatttactcg ggcttcccga cctggattgg tgtgcagtat       120
     caggtcagca gcttccgctt gggggccggc ctggcctttg cagggctggg ggctggggcc       180
     gattacatcg tgctcgagca ggccatcccg gctgcaccgg gcttcgacct gagctggtac       240
     gccggcgccg gggcctcggt ggggttctgg acggttctga gcaacaccgg tatttacatc       300
     ttcccccacg gtttggttgg cattgagtac gccttcccgg cccagccctt cagcgtttat       360
     ggcgagctcc aggtgggctt cgggattggt accggggcgc tctcgggtgt gattggaggc       420
     gtggacttca acgcacgggc tggcctaatt ttcagaccct ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page