(data stored in ACNUC7421 zone)

EMBL: CP001743.PE606

CP001743.PE606       Location/Qualifiers
FT   CDS_pept        599372..600022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0621"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gur:Gura_0756 polymorphic outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27388"
FT                   /protein_id="ADD27388.1"
FT                   /translation="MRYAPLLFLLLLAGCQRPGDTQPPLIGITQPKSGVLSQRSLQVQG
FT                   YALDDVGVQSVKAGGKELLPEASRGQKLVRFTFRVQAPQSGQVEIKVDATDMSGQTRTV
FT                   RLPLVLDARPPQIVIERAERVVTVVQPAHKRTLPDGTEEEIPARTESTLQISGRVLDDT
FT                   GVDRVTLQYNRTFSPLSLPKGKEVSFYVELPVRRVTLIAVDAAGNRTSVDVSR"
     gtgcggtacg cgccccttct ctttttgttg ctacttgcgg gatgccagcg gccgggggat        60
     acccagccac cgctcatcgg tattacccag cccaaaagtg gggtgctctc ccagcgctcg       120
     ctgcaggtgc aggggtacgc cctcgacgat gtgggggtgc agagcgtaaa agcgggcggg       180
     aaggaactgt tgcccgaagc cagccggggg cagaagctgg tgcgcttcac cttccgggtg       240
     caggcccccc agtcggggca ggtggagatc aaggtggacg ccaccgacat gagcggccag       300
     acccgcaccg tgcgcctgcc gctggtgctg gatgcccgtc ccccgcagat cgtcatcgag       360
     cgggccgagc gcgttgttac cgtggtgcaa ccggcccaca agcgcaccct gcccgatggc       420
     accgaggagg aaattccggc ccgcaccgag tccaccctgc aaatctccgg gcgggtgctg       480
     gatgataccg gggtggatcg ggttaccttg cagtacaacc gcacctttag cccgctgtcg       540
     ctacccaaag gcaaagaggt cagtttttac gtggagctgc cggtgcggcg ggtgaccctg       600
     attgcggtgg atgcagccgg caaccgcacc agcgtggatg tgagtcgctg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page