(data stored in ACNUC7421 zone)

EMBL: CP001743.PE607

CP001743.PE607       Location/Qualifiers
FT   CDS_pept        complement(600024..601118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0622"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; SPTR: A3V742 Zinc ABC
FT                   transporter, permease protein; InterPro IPR001626; COGs:
FT                   COG1108 ABC-type Mn2+/Zn2+ transport systems permease
FT                   components; KEGG: bsu:BSU30740 manganese ABC transporter;
FT                   PFAM: ABC 3 transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27389"
FT                   /protein_id="ADD27389.1"
FT                   /translation="MNADLVIILTAILVSTASALVGSFLVLRRMALLSDAISHAVLPGI
FT                   VLAYWLSGGERATVPALLGAAAAGLVTVVLVEWLTRTGKVKNDAAIGIVFPALFSLGVL
FT                   AVSLFFRNVHLDMDAVLYGEIAYAPFNTLNLWGREVPESWLVMGSLTLLNLLFVLLFYK
FT                   ELKLSTFDPGLAAALGLAPGALHYGLMTLVSFTSVGAFQSVGAILIVAFLIIPPATAYL
FT                   LTRRLPVMIALAVGVGVVSSLAGYALAIWLDASIAGMMATVAGLCFTLAFLFSPVEGYL
FT                   TARLRRERQRLEVAARLLVAHLAHHDQPVPEGEVLEEFGWNPRFLKQVREKARQAGWLE
FT                   VVREGLRPTARGLAMSSALLEPDP"
     atgaacgccg acctggtaat tatcctcacc gccatcctgg tctccacggc ctcggccctg        60
     gtgggcagct tcctggtgct gcgccgtatg gccctgctgt ccgatgccat ctcccacgcg       120
     gtgctgccgg gcatcgtgct ggcctactgg ctttccggcg gcgagcgggc cactgtaccg       180
     gccttgctgg gggccgccgc cgcgggcctg gtgaccgtgg ttctggtgga gtggctaacc       240
     cgcaccggca aggtcaaaaa cgatgcggcc atcggaatcg tgttccctgc gctgtttagc       300
     ctgggggtct tggcggtctc gcttttcttc cgcaacgtgc acctggacat ggacgccgtg       360
     ctctacggtg agatcgccta tgcccccttc aacaccctga acctgtgggg ccgggaggtg       420
     cccgagtcgt ggctggtgat gggctcgctc accctgctca acctgctgtt cgtgctgctg       480
     ttttataagg aactcaagct ctctaccttc gatcctggcc tggccgccgc gctgggcctc       540
     gcacccggcg cgctgcacta cggtctgatg accctggtct ccttcacctc ggtgggggct       600
     ttccagtcgg tgggagccat tttgattgtg gccttcctga tcattcctcc cgctacggcc       660
     tacctgctca cgcggcgcct gccggtgatg attgccctgg cggtgggggt cggggtggtt       720
     tccagcctgg cgggatatgc gctggccatc tggctggacg cctccatcgc cggcatgatg       780
     gccacggtgg ccgggctttg ctttaccctg gccttcctct tttcgcccgt ggagggctac       840
     ctcaccgccc gcctgcgccg ggaacgacag cgcctcgagg tcgccgcccg cctgctggtc       900
     gcacacctgg cccaccacga tcagccggtg cccgaagggg aggtgctcga ggagttcggg       960
     tggaaccctc gctttctcaa gcaggtgcgg gaaaaggccc ggcaagcggg ctggctcgag      1020
     gtggtgcggg aagggctgcg cccgacagca cgcggcctcg ccatgagcag cgccctgctc      1080
     gagcccgacc cataa                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page