(data stored in ACNUC7421 zone)

EMBL: CP001743.PE61

CP001743.PE61        Location/Qualifiers
FT   CDS_pept        53507..54226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0062"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; SPTR: A6C2N0 Putative short-chain
FT                   dehydrogenase; InterPro IPR002347:IPR013968:IPR002198;
FT                   COGs: COG1028 Dehydrogenase with different specificities
FT                   (related to short-chain alcohol dehydrogenase); KEGG:
FT                   oan:Oant_3756 short-chain dehydrogenase/reductase SDR;
FT                   PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26843"
FT                   /protein_id="ADD26843.1"
FT                   /translation="MVEFSRDLLGLEQRIVMVTGAGRGFGRSIARSYARNGATVITVDP
FT                   DVEMATAIASEVEQLGAPAIPIRGDMSVVLDVINTFEKIEELFGMLDGIVHVTSAESKT
FT                   PFVELLEAEWYDLLNADVKSSLYVLQQGLRYLSGGGFVTLVLPPLQREQPHVAAIRGAV
FT                   TGLIEGATRVFPTNVRVNGVIPSRDPVGEEHDRSLVRVAVALGSMVSEGVRGQLLEVLL
FT                   PDPPHQPEIYDLLRELP"
     atggtcgaat tttcacgaga tttactaggc ttggagcagc gcatcgtcat ggtcaccgga        60
     gcggggcggg gctttgggcg ttcaattgcc cgttcttacg cccgcaatgg ggccacggtt       120
     atcacggtag accccgacgt ggagatggcg accgccatcg cctccgaggt tgagcagctt       180
     ggcgccccgg ccattcccat ccggggggat atgtcggtgg tgctggatgt gatcaacacc       240
     ttcgagaaaa tcgaggagct ctttgggatg ctggatggga tagtccacgt gaccagcgct       300
     gagagcaaaa ccccctttgt agagctgctg gaggccgagt ggtacgatct gctcaacgcc       360
     gatgtaaagt cgagcctgta cgtgttgcag cagggcctgc gctacttgag cggggggggg       420
     ttcgtcaccc tggtactccc ccccctgcag cgcgaacagc cccacgtggc cgccattcgc       480
     ggtgcggtga ccggcctgat tgaaggggcc acccgggtct tccccaccaa cgtgcgggtc       540
     aacggggtca tccccagccg cgacccggtg ggtgaggagc acgaccgatc cctggtgcgg       600
     gtggctgttg cgctgggctc gatggtttca gaaggggtgc ggggccagct cctggaggtt       660
     ctgctgcccg atccccccca ccaaccagag atctacgatc tgctgaggga gctgccatga       720
//

If you have problems or comments...

PBIL Back to PBIL home page