(data stored in ACNUC7421 zone)

EMBL: CP001743.PE610

CP001743.PE610       Location/Qualifiers
FT   CDS_pept        complement(603220..604185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0625"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; SPTR:
FT                   A2TQ92 Zinc ABC transporter, periplasmic zinc-binding
FT                   protein; InterPro IPR006129:IPR006128:IPR006127; COGs:
FT                   COG0803 ABC-type metal ion transport system periplasmic
FT                   component/surface adhesin; KEGG: tcx:Tcr_2149 periplasmic
FT                   solute binding protein; PFAM: Periplasmic solute binding
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27392"
FT                   /protein_id="ADD27392.1"
FT                   /translation="MRIRNHLKPSILLALLVLGLATQVSAQPDKISRLQPVRQTPVRVV
FT                   TTVNFITDLVQQVGGDRVRVEGLMGAGVDPHLYKASAGDVRRLQQADLVFYGGLHLEGK
FT                   MVELLERLPKAIAVTDAIPRERLIRPAGGFQGQFTYDPHVWFDVTLWQFTIGRVRDALS
FT                   QVDPAGASRYRANAEAYRKRLEQLDAFIRQQIAQVPPQQRVLITAHDAFNYLGRRYGLE
FT                   VRGLQGISTVSEAGTRDVQALADFIVERKIRAIFVESSVPRRAIDAVVAAVRARGWRVT
FT                   IGGELFSDAAGSPGTPEGTYVGMMEHNIRTIVNGLLGREP"
     atgcgaatcc gtaaccacct aaaaccctct atactactgg ccctgctggt gctgggcctt        60
     gcgacccagg tcagcgccca gccagacaaa atcagccggc ttcagccggt gcggcaaacc       120
     ccggtgcggg tggtgaccac ggtcaacttt atcaccgacc tggtacagca ggtggggggc       180
     gaccgcgtcc gggtggaggg cctgatgggg gccggggtag acccccacct ctacaaggcc       240
     tcggcgggcg atgtgcgccg gctccagcag gccgacctgg tcttctacgg cgggctgcac       300
     ctcgagggca agatggtgga gctgctggaa cgcctgccca aggccatcgc ggtgaccgac       360
     gccatccccc gcgagcgcct gattcggccc gctggtggct tccaggggca gttcacctac       420
     gacccccacg tctggttcga tgtgaccctc tggcagttca ccatcggccg ggtgcgggat       480
     gcgctcagcc aggtagaccc cgctggggcc agccgctacc gggccaatgc cgaggcctac       540
     cgcaagcgcc tcgagcaact ggatgccttc atccgccagc aaattgccca ggttccaccg       600
     cagcaacggg tgttgattac cgcccacgac gcctttaact atctgggcag gcggtacggc       660
     ctcgaggtgc ggggcttgca gggcatctcc accgtatccg aggccggcac ccgcgacgtg       720
     caggccctgg ccgacttcat cgtggagcgt aaaattcgcg ccatcttcgt ggagtccagc       780
     gtgccccggc gcgccattga tgcggtggtg gcagcggtgc gggctcgagg ctggcgtgta       840
     accatcggag gcgagctttt ttccgacgct gccggcagcc ccggcacccc cgagggcacc       900
     tatgtgggca tgatggagca caacatccgc accatcgtga acggtctgct ggggagggag       960
     ccgtga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page