(data stored in ACNUC7421 zone)

EMBL: CP001743.PE611

CP001743.PE611       Location/Qualifiers
FT   CDS_pept        complement(604172..604891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0626"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="PFAM: iron dependent repressor; FeoA family protein;
FT                   regulatory protein MarR; SMART: iron dependent repressor;
FT                   InterPro IPR000835:IPR007167:IPR001367; KEGG: tcx:Tcr_0904
FT                   iron dependent repressor; COGs: COG1321 Mn-dependent
FT                   transcriptional regulator protein; SPTR: Q9HRU8
FT                   Transcription repressor; PFAM: FeoA domain; Iron dependent
FT                   repressor, N-terminal DNA binding domain; Iron dependent
FT                   repressor, metal binding and dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27393"
FT                   /protein_id="ADD27393.1"
FT                   /translation="MNRTTHRTPLSEAQEDYLKQVLLLGSGEGMGRLEDTLPVSTQSLA
FT                   DRMQVKPASVTGMLKKLAELGLVEYEAYRGVRLTEAGYKVALEVLRHHRLIEAYLHQAL
FT                   GYGWEEVHAEAEKLEHHISEAFEQRIAEWLGHPSHDPHGDLIPSAALELPPTTPNRRLA
FT                   ALQSGQYGTVARVATQDQDALNLLARLGLKPGASLRLLEQGAEGSRIQVGGQRYLLPTS
FT                   LAQVLWIQIEEDQDANP"
     atgaacagaa ccacccaccg cacccccctc tccgaggccc aggaagacta tctaaagcag        60
     gtcttgctgc taggcagcgg ggagggcatg ggccggctgg aggacaccct gccggtatcc       120
     acccaatcgc tggccgaccg gatgcaggtc aagccggcct cggtcaccgg gatgctcaag       180
     aagctggccg agctgggctt ggtggagtac gaggcctacc ggggcgtgcg gctcaccgag       240
     gccggctaca aggtggccct cgaggtgctc cgccatcacc ggctgattga ggcctatctg       300
     caccaggcgc tgggctacgg ctgggaggaa gtgcacgccg aggcagaaaa gctcgagcac       360
     cacatctcgg aagccttcga acagcgcatc gccgagtggc tgggccaccc ttcccacgac       420
     ccccacggcg atctcatccc cagcgcggcc ctcgagctac cccccaccac ccccaaccgc       480
     cgcctggcag ccttgcaaag cggccagtac ggcacggtgg cacgggtagc cacccaggat       540
     caggacgcgc tcaacctgct ggcccgtctg ggtctcaagc ccggcgcttc gctgcggctg       600
     ctcgagcagg gggccgaggg cagccgcata caggtaggag gccagcgcta tttgctgccc       660
     accagcctgg cccaggtgct gtggatacag atcgaggagg atcaggatgc gaatccgtaa       720
//

If you have problems or comments...

PBIL Back to PBIL home page