(data stored in ACNUC7421 zone)

EMBL: CP001743.PE616

CP001743.PE616       Location/Qualifiers
FT   CDS_pept        609107..610198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0631"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A3TKH1 ABC-type sugar
FT                   transport systems, permease component; InterPro IPR000515;
FT                   COGs: COG1175 ABC-type sugar transport systems permease
FT                   components; KEGG: sme:SMa1363 ABC transporter, permease;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27398"
FT                   /protein_id="ADD27398.1"
FT                   /translation="MLRSRRTEALYALLFLAPFLIHLGIFFVFAFVRTVGFSFTDATLI
FT                   GQSSRFVGFANFVELFREPRFLAAFTHSISFMLVVTTLQTFLALVLAAVLNQRLRGITF
FT                   FRTVYYIPSVLSSAAVTVIAIWFFQKTGFLNTFIGYIGSVAPVLLVFGGLFVLAQAVQV
FT                   GWERWRGVPVPWLDPALATISLVVALALTWGLVGLGVVRPLEARPPEFTWLTNPDRFLG
FT                   IPIPLWSIVILNTFTTIPTLMLIFLAGLQDIPKSLYEAASIDGASPVQQFFSVTVPMLR
FT                   PVTFLVITLSLIGTLQMFDQVALMGDAAPLDSIIVLAYYVYNNVFSGEGQVGLASAAAL
FT                   ILAGLTFAIVLLQRALGISEKAH"
     atgcttcgtt cgcgacgaac cgaagcgctg tatgcgctgc tgtttctggc cccgtttctg        60
     attcacctgg gaattttctt cgtcttcgcc tttgtccgca cggtgggctt tagctttacc       120
     gacgccaccc tgattgggca gtcgagccgg tttgtgggct tcgcgaattt tgtagagctc       180
     tttcgcgagc cgcgctttct ggccgctttt acccactcca tcagcttcat gctggtggtc       240
     accaccctgc aaacctttct ggctttggtt ctggcggcgg tgcttaacca gcggctgcgc       300
     gggattacct ttttccgcac ggtttactac atccccagcg tgctctcctc ggctgccgta       360
     acggtaattg ccatctggtt tttccagaaa accggtttcc tgaacacctt tattgggtac       420
     attggctcgg tggccccggt gctcctggtc tttgggggcc tttttgtgct ggcccaggcg       480
     gtgcaggtgg gctgggaacg ctggcggggg gtgccggtgc cctggctcga cccggccctg       540
     gccaccatct cgctggtggt ggcgctggcc ctcacctggg ggctggtggg gctgggggtg       600
     gtgcggcccc tcgaggcccg tccccccgag ttcacctggc tcaccaaccc cgaccgcttt       660
     ctggggattc ccatcccgct ttggagcatc gttatcctca acaccttcac caccattccc       720
     accctgatgt tgatcttcct ggcaggtttg caggacattc ccaaaagcct ttacgaggca       780
     gcctccattg acggggcctc gcccgtgcag cagttcttta gcgtgaccgt gcccatgctg       840
     cgcccggtga cttttttggt gattactttg tcgctcattg gcaccttgca gatgttcgac       900
     caggtggccc tgatgggcga cgcggccccg ctggactcga ttatcgtgct ggcctattac       960
     gtctacaaca acgtgtttag tggggagggc caggtgggcc tggcctcggc ggcggccctg      1020
     attctggccg ggctgacctt cgccattgtg ctcttgcaac gggcgctggg catctcggag      1080
     aaggcccatt ag                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page