(data stored in ACNUC7421 zone)

EMBL: CP001743.PE618

CP001743.PE618       Location/Qualifiers
FT   CDS_pept        611664..613535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0633"
FT                   /product="Amylo-alpha-16-glucosidase"
FT                   /note="PFAM: Amylo-alpha-16-glucosidase; SPTR: A3WRY8
FT                   Amylo-alpha-1,6-glucosidase; InterPro IPR010401; COGs:
FT                   COG3408 Glycogen debranching protein; KEGG: gdj:Gdia_2125
FT                   amylo-alpha-16-glucosidase; PFAM:
FT                   Amylo-alpha-1,6-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27400"
FT                   /protein_id="ADD27400.1"
FT                   /translation="MLPLKEDDTYAVLSDQGLVEAGEQGFYRHDTRYLSSYTWVLPGFR
FT                   LLLSQSPRPDRLVQHWSWIKGPDQVVGVRRELQMERGGFWERLEFENTSLEAQAVEITL
FT                   RAQADFADLFEAKGWHRVERRLEGLEYTAPDGLRLATRLTCDPPPVQETALEGGALYTW
FT                   RFDLAPKQKALLHLKGRFESPFEPHTPPLPSYEAWRQRFPLHLESGHSQRVLEQAIADL
FT                   RALLFSLPEGLFPAAGIPWYVCPFGRDSLLTAYMMQPWASEVTQGVLTYLARHQGREVN
FT                   PFLDETPGKIIHEVRLGELSRTGQVPFARYYGTVDATPLFVILLHRYWKDSGDMAFVRR
FT                   LQPHWEAALAWMTDYADPDQDGFLEYAPNTQKGHLVQSWKDSFDSQSHRDGSLAQGAIA
FT                   VCEVQGYAYMAYQSAAAFYRALGQTGQAEAWESRAQALRDLFHQKFWLPELKTYAAGLD
FT                   GQKKPMAILTSNPGHLLWSGIVPEEVAPQLVETLFSEALFSGWGVRTLGAGEVRYNPLS
FT                   YHNGSVWPHDNALLIGGLVRYGFYEEALRAMEALFRLAMSQPDGRLPELVGGYPKHEEE
FT                   PPVPYPASCRPQAWDAAAVVYMLRLIHEIDQKREVKGLLELRKVKVQ"
     atgcttccgc tcaaagaaga cgatacttac gcagttttat cagaccaggg cctggtagaa        60
     gcaggggagc agggctttta ccggcacgat acccgctacc tctcgagcta cacctgggtg       120
     ctgccgggct ttcgcctgct gctctcgcaa agcccccgcc ccgaccggtt ggtgcagcac       180
     tggagctgga ttaagggccc cgaccaggtg gtgggggtgc ggcgggaact ccagatggag       240
     cggggtgggt tctgggagcg gttggagttc gagaacacct cgctagaggc ccaggccgtg       300
     gagattacct tgcgggccca ggccgacttt gccgaccttt tcgaggccaa gggctggcac       360
     agggtggagc ggcggctgga gggcctcgag tacaccgccc ccgacggcct gcggctggcc       420
     acccgcctca cctgcgaccc cccgcccgtt caagaaacag cgctcgaggg cggcgcgctg       480
     tacacctggc gcttcgacct ggcccccaaa caaaaagccc ttctgcacct gaagggccgc       540
     ttcgaaagcc ccttcgagcc ccacacccca cccctgccca gctatgaggc gtggcggcag       600
     cgcttccccc tgcacctgga aagcgggcac agccagcggg ttttggagca ggctatcgcc       660
     gatctgcggg ccttgctctt ctccctaccc gaagggttgt ttcccgcggc agggattccc       720
     tggtatgtct gcccttttgg ccgcgactcc ctgctgacgg cctacatgat gcagccctgg       780
     gccagcgagg taacccaggg ggtgctgacc tacctcgcca ggcaccaggg ccgggaggtg       840
     aacccgtttc tggacgagac ccctggcaaa atcatccacg aggtgcgctt aggcgagctt       900
     tcgcgcaccg gccaggtgcc ttttgcccgc tactacggca ctgtggacgc caccccgctg       960
     tttgtcatcc tgctgcaccg ctactggaaa gacagcggcg atatggcctt tgtgcgccgc      1020
     ttacagcccc actgggaggc ggccctggcc tggatgaccg actacgccga ccccgaccag      1080
     gacggctttc tggagtacgc ccccaacacc cagaagggcc acctggtgca gtcctggaaa      1140
     gactccttcg actcccagag ccaccgcgac ggctcgctgg cccagggggc tattgcggtt      1200
     tgcgaagtac agggctatgc ctatatggcc tatcagtcgg cggcggcgtt ttaccgggcg      1260
     ctgggccaga ccggtcaggc cgaagcatgg gagtctcgag cccaggccct ccgagacctt      1320
     tttcatcaga agttctggct gccggaatta aaaacctacg cggcaggctt agacggccag      1380
     aaaaaaccca tggccatcct tacctccaac cccggccacc tgctgtggag cggcatcgtg      1440
     ccggaggagg tggcccccca actggtcgag accctcttct ccgaggcgct ttttagcggc      1500
     tggggggtgc gcacgctggg cgcgggggag gtgcgctaca acccgctctc gtaccacaac      1560
     ggctcggtct ggccgcacga caacgcgctg ttgattgggg ggctggtgcg ctacggcttt      1620
     tacgaagagg ccctgcgggc tatggaggcc ctcttccgcc tggccatgag ccagcccgac      1680
     gggcgcctgc cggagctggt agggggctac cccaagcacg aagaggaacc gccggtgccc      1740
     tacccggctt cttgcaggcc ccaggcctgg gacgcggcgg cggtggtgta tatgctgcgc      1800
     ttgatccacg aaatagatca aaagcgtgaa gtgaaggggc tcttggagct gcgcaaggtc      1860
     aaggtgcagt ga                                                          1872
//

If you have problems or comments...

PBIL Back to PBIL home page