(data stored in ACNUC7421 zone)

EMBL: CP001743.PE619

CP001743.PE619       Location/Qualifiers
FT   CDS_pept        613612..614394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0634"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; SPTR: A4KG97
FT                   N-acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha-D-
FT                   glucopyranoside deacetylase mshB; InterPro IPR003737; COGs:
FT                   COG2120 conserved hypothetical protein LmbE homologs; KEGG:
FT                   bha:BH3320 hypothetical protein; PFAM: GlcNAc-PI
FT                   de-N-acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27401"
FT                   /protein_id="ADD27401.1"
FT                   /translation="MRLLAVFAHPDDESFFCAGTLAKYAALGHEVYLICATRGEQGRIR
FT                   HPAIDASLYPKGEALGKLREKELEAACAVLGLRPPIFLGYQDSGYPLEVAQANPRGFMH
FT                   QDLQQIEDVLLGYMAQLKPQVVIGFDPQGYYGHADHIHLHRATLGAFWRAGNVMPEPPK
FT                   RLFFPVRTKERVAQTRFDPERYGVSPCSLAVRVDVRPLAPTIRAAVLAHASQAGPEENF
FT                   SQVLLDWPGLLEEETFVLGGLRGSFPAMPVDDLLAEWS"
     atgcgtttat tggctgtttt tgcccacccc gacgacgagt cgtttttctg cgccggaacc        60
     ttagccaagt atgcggcttt ggggcacgaa gtgtacctga tctgcgccac gcgcggagag       120
     cagggccgaa tccgccatcc ggccattgac gcttcactgt atcccaaggg tgaggctttg       180
     ggtaagctgc gtgaaaagga gctcgaggcc gcctgcgctg tgctgggttt gcgcccgccc       240
     atctttctgg gctaccagga ctcggggtat ccgctcgagg tcgcccaggc caaccccagg       300
     ggcttcatgc accaggatct gcagcagatc gaggatgtcc tgctggggta catggcccag       360
     ctaaagcccc aggtggtcat tgggttcgac ccgcagggct actacggcca tgccgaccac       420
     atccaccttc accgggccac cctgggggcc ttctggcggg ccggcaatgt gatgcccgaa       480
     ccgcccaagc gcctcttttt tccggtacgc accaaagagc gggtggccca gaccaggttc       540
     gaccccgagc gctatggggt ttcgccctgc tcgctggcgg tgcgggtgga cgtgcgcccc       600
     ttggctccga ccatccgggc ggcggtgctg gcccatgctt cgcaggccgg gcccgaggag       660
     aacttttctc aggtgctgct ggactggccg ggcctgctgg aagaagagac cttcgtgctg       720
     ggcgggctgc gggggtcttt cccggccatg ccggtagacg atctgctggc ggaatggtct       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page