(data stored in ACNUC7421 zone)

EMBL: CP001743.PE62

CP001743.PE62        Location/Qualifiers
FT   CDS_pept        54264..54785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0063"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein; SPTR: Q5SM09
FT                   Transcriptional repressor nrdR; InterPro
FT                   IPR005144:IPR003796; COGs: COG1327 transcriptional
FT                   regulator protein consists of a Zn-ribbon and ATP-cone
FT                   domains; KEGG: smd:Smed_0817 hypothetical protein; PFAM:
FT                   ATP cone domain; TIGRFAM: transcriptional regulator NrdR"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26844"
FT                   /protein_id="ADD26844.1"
FT                   /translation="MNCPFCGNPDSRVLDSRPSDEGSVIRRRRECPVCKRRFTTYERAQ
FT                   VEPLLVIKRSGRKETFDPNKLLRGLSLAARKRPIDPEVLQEFAFGFEDTVKEMEITSEE
FT                   IGLRSLAFLKELDPVAYIRFASVYREFDSLENFIEEVRKLDRKPGKGKKAQKAEEETPD
FT                   LADEAKLGTV"
     atgaactgtc ctttttgtgg gaaccccgat agccgcgtgc tggactcgcg tccttccgac        60
     gagggctcgg tgattcgccg ccgccgggag tgcccggtct gcaagcgccg cttcaccacc       120
     tatgagcggg cccaggtgga gccgctgctg gtcatcaagc gctcggggcg taaagagacc       180
     ttcgacccca acaaactttt gcgcggcctg agcctggccg cccgtaaacg gcccatcgat       240
     ccggaggtgt tgcaggagtt tgccttcggc ttcgaagata ccgtcaagga gatggaaatt       300
     acctccgagg agatcgggct gcgttcgctg gccttcctga aggagctcga tccggtggcc       360
     tacattcgtt tcgcctcggt ttaccgcgag tttgacagcc tggagaactt tattgaagag       420
     gtgcgcaagc tggatcgcaa gccaggcaag ggtaaaaaag cccagaaggc agaagaagaa       480
     acacctgacc tggccgatga ggccaagctg ggaacagtct ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page