(data stored in ACNUC7421 zone)

EMBL: CP001743.PE623

CP001743.PE623       Location/Qualifiers
FT   CDS_pept        complement(619371..620147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0638"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: B8XNP4 Platelet
FT                   glycoprotein Ib alpha polypeptide; PFAM: PEGA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27405"
FT                   /protein_id="ADD27405.1"
FT                   /translation="MNALLLWILGILGVLIMLWGLTRLPRGGLAWLGFGLVLGLAGLGG
FT                   AWLHQQYGTTVFWGLGILGVLLLVWALLNLRSRLAGWSAGLAVLLVLTGFGSIVLLNSS
FT                   SPNLLTSGTIPNPLNNFQTDPGSAPDGPTTNPTPPAETTPEPTPTPPETDPSQPATEPS
FT                   PSPAEPAPTAPVASGSVREVDPACPCLLSVRVKAPNPTVRILQDGTEVASSKLEYSSFS
FT                   LEAGDYTLQVEAPGYRTLSTLINVPRNKNLEVELAQ"
     atgaacgcac tcttactctg gattctgggc attctgggcg tgcttattat gctctggggc        60
     ctcacccgcc taccgcgcgg tgggctggcc tggctgggct ttggtttggt gctgggcctg       120
     gctgggctgg gcggggcctg gctgcaccag cagtacggca caaccgtctt ctgggggctg       180
     ggcatcctgg gggtgctgct gctggtctgg gccctgttga acctccggag ccgcctggca       240
     ggttggagcg ccggtctggc cgtgctgctg gtgcttaccg gctttggcag catcgtactg       300
     ctgaacagca gcagccccaa cctgctcacc tcgggtacca ttcccaaccc gctcaacaac       360
     ttccaaaccg accccggcag cgcgccagat ggccccacaa ccaaccccac gccgccggct       420
     gagaccaccc ctgaaccaac ccccaccccg cccgagaccg atccatccca gcccgcaacc       480
     gagccttcgc cgtcccctgc cgagcccgcc cccaccgcgc cggttgcttc aggcagtgtg       540
     cgcgaggttg atccggcctg cccctgtctc ctcagcgtgc gggtgaaagc ccccaacccc       600
     acggtgcgca ttctgcagga cggcaccgag gttgccagca gcaagctcga gtactcgagc       660
     ttctcgctcg aggccggcga ctacaccctg caggtcgaag cgcccggcta tcgcaccttg       720
     agcacgctga ttaatgtgcc cagaaacaaa aacctggaag tagagctggc gcagtaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page