(data stored in ACNUC7421 zone)

EMBL: CP001743.PE626

CP001743.PE626       Location/Qualifiers
FT   CDS_pept        complement(622427..623944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0641"
FT                   /product="Fibronectin-binding A domain protein"
FT                   /note="PFAM: Fibronectin-binding A domain protein; protein
FT                   of unknown function DUF814; SPTR: A6P056 Putative
FT                   uncharacterized protein; InterPro IPR008616:IPR008532;
FT                   COGs: COG1293 RNA-binding protein homologous to eukaryotic
FT                   snRNP; KEGG: bsu:BSU15640 hypothetical protein; PFAM:
FT                   Domain of unknown function (DUF814); Fibronectin-binding
FT                   protein A N-terminus (FbpA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27408"
FT                   /protein_id="ADD27408.1"
FT                   /translation="MEGLQIHAALRTLAPQLPRRSLGWAFPDEGTAALLLEGLGNLLLR
FT                   YRPPHPLLALEADRVAGEAKTPFQRLLEARCKGRLLKIEQLKLDRVVFLEFEGEKGFVD
FT                   TAPTRLVFELTGRNANLMVLDLEGRIIGIDRPVTPAINRYRELRSGLFYTPPPPYQKLD
FT                   PRTLQEDGLKPFVGQPLEQLIKNLDGVGKALGAELCRRAHLRPQTPLEPAHLPLIHKVI
FT                   HSLVEQPSLQTASPDLQTAWAQEEAEALRKPLREALQRQLRTLQARLGDAHNALERLEE
FT                   AQRLRNWGDLLMAYGHQLPPGPTAKLEDFSGQMVEIPLEAGLSPIQNASRFYARAKRLE
FT                   ANAERALEQIPAMEAQIAGLEQELAQLEHLSRQALQALKRKTREKGPQLGLRLTSPSGF
FT                   EVWVGRNSKENDLLTRMAHSEDLWFHAQGLPGSHVILRTQGRPAPLPDLLYAAQLAAHH
FT                   SKARGEKNVPVDYTAKKHVWRPRKAAPGQVLYTQVKTLFVDARLPTS"
     atggaaggtt tgcagataca cgcagcactg cgcaccctgg ccccccagct accccggcgc        60
     agcctgggct gggcgttccc cgacgagggc accgccgccc tgctcctgga agggctgggc       120
     aatctactgt tgcgctaccg cccaccccat cccctcctgg cactggaggc ggatcgtgtg       180
     gcgggcgagg ccaaaacccc ttttcagcgc ctcctcgagg cccgctgcaa ggggcgcttg       240
     ctaaaaattg aacagctcaa gctcgaccgg gtggtttttt tggagtttga aggggaaaag       300
     ggctttgtgg ataccgcccc cacccggctg gtctttgagc tcacgggccg caacgccaac       360
     ctgatggttt tggacctcga gggccggatt atcggcatag atcgcccggt tacgcccgcc       420
     atcaaccgct accgcgaact gcggagcggg cttttctaca ccccaccccc gccctaccag       480
     aagctcgacc cccgcaccct gcaggaagac gggctgaagc cctttgtggg ccagcccctc       540
     gagcagctca tcaaaaacct ggacggggtg ggtaaagccc tgggggccga gctctgccgg       600
     cgcgcacacc tacgcccgca aaccccgctc gagcccgcac acctgccact tatccacaaa       660
     gttatccaca gcctggtcga gcagcccagc ctgcaaaccg cctcccccga tctccagacc       720
     gcctgggcgc aggaagaagc cgaggctctg cgcaaacccc tacgcgaggc cctccagcgg       780
     cagctccgaa ccttgcaggc ccgcctgggg gatgcccaca acgccctgga gcgcctggaa       840
     gaggcccagc gcctgcggaa ctggggcgac ttgctgatgg cctacggcca ccagcttccg       900
     ccggggccca cggccaaact ggaggatttt tccggccaga tggtggaaat tcccttagaa       960
     gccgggctct cccccattca gaacgccagc cgcttctatg cccgggccaa gcgcctcgag      1020
     gccaacgccg agcgggctct ggagcagata ccggccatgg aggcccagat cgccgggctc      1080
     gagcaggaac tcgcccagct cgagcatctc tcccgtcagg cgttgcaggc cctgaagcgc      1140
     aaaacccgcg agaaaggccc ccagctaggc ctgcgcctca ccagccccag cggctttgag      1200
     gtctgggtgg ggcgcaacag caaagaaaac gacctcctga cccgcatggc ccactccgaa      1260
     gacctctggt tccacgccca gggcctcccc ggttcgcacg tgatcctgcg cacccagggc      1320
     cgccccgcac ccctgcccga cctgctctac gccgcacagc tcgccgccca ccactccaaa      1380
     gccaggggcg aaaaaaacgt cccggtggac tataccgcca aaaaacacgt ctggcgcccc      1440
     cgcaaagcgg cccctggcca ggtgttgtat acccaggtta agaccctgtt tgtggatgcc      1500
     aggctgccca cgagctga                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page