(data stored in ACNUC7421 zone)

EMBL: CP001743.PE627

CP001743.PE627       Location/Qualifiers
FT   CDS_pept        complement(624033..624839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0642"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A0NU04 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27409"
FT                   /protein_id="ADD27409.1"
FT                   /translation="MLSIRSALLLWIALALAMPSGLAAQVKASSQPDLVPDTQVIVQRG
FT                   GGNGNGAGNNGNGNSGNGNSGGNNGNSGGNNSNSGGNNNTGGSNAAGNGNSNAAGNNPN
FT                   PSSNPSSTRQPRSYMGQVTVSAGGLVISGSVRIQSNSPWLSLAVPGMWLEATGVWEDDV
FT                   FVATDVKLHSPVPWAFYQGPGSLIGASQYQFVSAWLTNSRNDPFLALRAASEQSQVRVV
FT                   AYFDGNKFRALPSSFPVPPGLKPGWYELMGTVGSQGVVWSSSKAFP"
     atgcttagta tccgcagcgc gctcttacta tggattgccc ttgccttggc catgccctcc        60
     ggcttggctg cccaggtcaa agccagcagt cagcccgacc ttgtgcccga tactcaagtt       120
     attgttcagc gtggcggcgg caacgggaat ggcgctggaa acaatggcaa cggcaacagc       180
     ggtaatggca atagcggtgg caacaacggc aacagtggtg gaaacaacag caatagcggc       240
     gggaataaca acaccggggg cagcaacgct gccggaaacg gcaacagcaa cgcggctggg       300
     aacaacccga accccagctc caacccctcg agcacccgcc aaccccgcag ctacatgggc       360
     caggtaacgg tcagtgctgg cggcctggtt atttcaggga gcgtgcgcat ccaaagcaat       420
     tcgccctggt taagcctggc agtgccgggt atgtggctcg aggccaccgg cgtctgggaa       480
     gacgatgtgt ttgtggctac cgatgtcaag ctgcatagcc ccgtaccctg ggctttttac       540
     caggggccag gcagcctgat aggggccagc cagtaccagt ttgtgagcgc atggcttacc       600
     aatagccgca acgacccttt cctggcgctt cgggctgcca gtgagcagtc tcaggttcgg       660
     gtggtggcct atttcgatgg aaacaagttt cgggcgcttc cgagcagttt tccagtaccc       720
     cctggactca agcctggttg gtacgagttg atgggtaccg ttggctccca aggggtggtc       780
     tggtcttcga gcaaagcctt cccatag                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page