(data stored in ACNUC7421 zone)

EMBL: CP001743.PE628

CP001743.PE628       Location/Qualifiers
FT   CDS_pept        complement(624832..626154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0643"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein;
FT                   InterProIPR004358:IPR003594:IPR003661:IPR003660:IPR 005467;
FT                   KEGG: ppf:Pput_1406 integral membrane sensor signal
FT                   transduction histidine kinase; COGs: COG0642 Signal
FT                   transduction histidine kinase; SPTR: A6P0U2 Sensor protein;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; His Kinase A (phosphoacceptor) domain; HAMP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27410"
FT                   /protein_id="ADD27410.1"
FT                   /translation="MPPSKAVQALHILLSRPKGRLLGGFRSRLLLGLSSVVVLTALLVG
FT                   VLGFLQFQSTLSQEAWQDLISATNIVEQALLITPEQVLLNPDRLPRLAELGNSRFRVIR
FT                   TEQVFLEIGGRYPTQSTGWIKTERPLEYGFVLQAALETHSQSEALRTFWQTELLALPIS
FT                   LLLALVVAYLLFGYLMHPVRHLTEATHAIAQQRFPKPIPVPPGQDELSDLAESFNRMTQ
FT                   AVEGFLERERNFSRYASHELRTPLATLRAQIEALEQGLLTPQESLPAIKRSLERLEHLL
FT                   AALLALTRIPHKNPEPVEVGAVLHAVVQNLLLKEQQRITLKGNLGAQVLGYEELLQQAL
FT                   SNLVNNALKFSQGQVEVEVRQGAVIQIHIRDRGPGVPEKDIPRLGTPFLRVQPKVDGMG
FT                   LGLALVRHIASVMGGELEFSNRPGGGLEAILSLPSLEVSHA"
     gtgccgccaa gcaaagccgt acaagctctg cacattttac tgtccaggcc caaaggacgg        60
     ctgttgggtg ggtttcgcag tcgcttgctg ttgggtctgt cgtctgtggt ggtgctgaca       120
     gccttgctgg tgggggtact gggttttctg cagtttcaaa gcaccttaag ccaggaagcc       180
     tggcaagatc tcatttctgc aaccaatatt gtagagcagg ctttactaat tacacccgaa       240
     caggttttgc tcaacccgga tcgccttccc cggctggccg agctgggcaa cagccgcttc       300
     cgggtgataa gaacagagca ggtgttttta gaaatcggcg ggcgctaccc aacccaaagc       360
     actggctgga tcaaaactga gcggccgctg gaatatgggt ttgtcctgca agccgcgctc       420
     gagacacaca gccaaagcga agccctgcgg actttctggc aaaccgaact gctggcactg       480
     cccatctcgc tgctgctagc gctggtcgtg gcctacctgc tttttggcta cctgatgcac       540
     ccggtgcgac atctaaccga agccacccat gccatcgccc agcaacgctt ccccaaacca       600
     attcccgtgc cacccggcca agatgagctt tctgatctgg ccgagagttt caatcgaatg       660
     acccaggcgg tggaagggtt tttagaacgg gagcgcaatt tttcacgcta cgcctcacac       720
     gagttgcgca cccctttagc aaccttgcgg gcacaaattg aggccctgga gcaaggactg       780
     ctcacccccc aggaatcctt accagccatc aaaagaagcc tcgagcgcct ggagcatctg       840
     ctggcggccc tgctggcctt aacccgcatc cctcacaaaa atcccgagcc ggttgaagta       900
     ggggctgtgc tacacgcggt ggtgcaaaat ctacttttaa aagagcagca acgtattacc       960
     ttaaagggta acttgggagc tcaggtgctg ggttatgaag aattgctgca gcaagctttg      1020
     agcaacctgg taaacaatgc cctcaagttc agccaggggc aggtggaggt cgaggtgagg      1080
     cagggggcgg tgatccaaat ccacattcgc gaccgggggc cgggggtgcc cgaaaaagac      1140
     ataccccgcc tgggcacccc tttcctacgt gtacagccca aagtagatgg gatggggctg      1200
     ggactggctc tggttcggca catcgcctct gtgatgggag gggagctcga gtttagcaac      1260
     cgccctgggg gtggcctcga ggctatcttg agcctgccca gcctcgaggt gagccatgct      1320
     tag                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page