(data stored in ACNUC7421 zone)

EMBL: CP001743.PE629

CP001743.PE629       Location/Qualifiers
FT   CDS_pept        complement(626159..626815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0644"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; InterPro IPR001789:IPR001867:IPR005829; KEGG:
FT                   bpy:Bphyt_2190 two component transcriptional regulator,
FT                   winged helix family; COGs: COG0745 Response regulators
FT                   consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain; SPTR: A3IMT2 Two-component
FT                   hybrid sensor and regulator; PFAM: Transcriptional
FT                   regulatory protein, C terminal; Response regulator receiver
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27411"
FT                   /protein_id="ADD27411.1"
FT                   /translation="MRILLVEDNADLAGPLLALLQRERYEVEWADNLSQAQALVDKLEP
FT                   DLIALDVMLPEGEDTGFRLARQLRRDGFGGAILFLTARDTVEDRVLGLDLGGDDYLVKP
FT                   FSLEELLARIRALLRRGSTLRQNVLERGPLRIEFASRKVCWNQQPVSLSDKEFVLLERL
FT                   ALHPERVFGVDELISKVFPNTKSGHRILRVYVHRLREKLGDSVIATQPGGYTLGV"
     atgcgaattt tattggttga agacaatgct gatctagcag ggccgctgct agccttgcta        60
     cagcgggaac gatacgaggt ggaatgggcc gacaacctgt cccaggccca ggcgttggtg       120
     gacaagctcg agcccgatct aatagccctg gatgtgatgc tgccggaagg agaagatacg       180
     ggctttcgtt tagcccggca acttcgcaga gatgggtttg gaggggctat cctgtttcta       240
     accgcacgcg ataccgtgga ggatcgggtg ctaggactgg atttgggtgg agacgactac       300
     ctggtaaagc ctttctccct agaagagctt ttggcacgca tccgagcgtt gctgcgaaga       360
     ggcagcacct tgcgccaaaa tgtcctcgag cggggccccc tacgcataga gtttgccagc       420
     cgtaaggtgt gctggaacca acaacccgtc tcactttcag acaaagaatt tgtattgctc       480
     gagcgcctag ccctgcaccc cgagagggtt tttggagtgg acgagttgat cagcaaggta       540
     ttccctaaca ccaagtcggg ccaccgcatc ctgcgggtct atgtgcatcg cctgagggaa       600
     aagctagggg atagcgtaat cgccacccag ccagggggat atacattggg ggtctaa          657
//

If you have problems or comments...

PBIL Back to PBIL home page