(data stored in ACNUC7421 zone)

EMBL: CP001743.PE63

CP001743.PE63        Location/Qualifiers
FT   CDS_pept        54821..55558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0064"
FT                   /product="protein of unknown function DUF164"
FT                   /note="PFAM: protein of unknown function DUF164; SPTR:
FT                   A6DEI7 Putative uncharacterized protein; InterPro
FT                   IPR003743; COGs: COG1579 Zn-ribbon protein possibly nucleic
FT                   acid-binding; KEGG: protein of unknown function DUF164 ;
FT                   K07164; PFAM: Putative zinc ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26845"
FT                   /protein_id="ADD26845.1"
FT                   /translation="MSDPLAELNRLQERDLELDQIREDQSRVPDELAQAREHFRKLEIS
FT                   LGDLQEQLREVRLAYNKLDLELQDLKSKREKAKAAQAQATGAKEQTQYGEQIRQLSGLI
FT                   EDLEGNNKDIVGQIMPLLEQIEKLEAELAQVKAQMEEARPKLEALETANQARVDALEAE
FT                   YQSKKVSRDQLAATIPTAIVKEYESIRRARKGTGLTKMAKAGNGYRCTACNVQLPMHVA
FT                   QQVHQASKVVRCPSCGRILWKGA"
     gtgagtgacc cgctggccga gttgaaccgt ttacaggaac gcgacctcga gcttgaccag        60
     attcgcgaag atcagtcccg cgttcccgat gagctggccc aggcccgtga gcacttcagg       120
     aaactggaaa tttctctggg cgatttgcaa gagcagctgc gcgaggtgcg cctggcctat       180
     aacaagctcg acctcgagct gcaagacctc aaaagcaagc gcgaaaaagc caaggcagcc       240
     caggcccagg ccaccggggc taaagagcag acccagtacg gcgagcagat tcgccagttg       300
     tcgggcctga ttgaagacct cgagggcaac aacaaggata tcgtcggtca gattatgccg       360
     ctgctcgagc agatcgagaa gctggaggcg gaactggccc aggtcaaggc ccagatggaa       420
     gaggcccggc ctaagctcga ggctttggag acagccaacc aggcgcgggt ggatgccctc       480
     gaggccgaat accagtccaa aaaggtcagc cgcgaccagt tagcggccac catccccact       540
     gccattgtta aggagtacga gtccatccgc cgggctcgca aaggcaccgg cctgaccaaa       600
     atggccaagg ccggcaacgg ctaccgctgc accgcctgca atgtgcagct tcccatgcac       660
     gtggcccagc aggttcacca ggccagcaag gtggtgcgct gcccctcctg cgggcgcatt       720
     ctttggaaag gcgcgtag                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page