(data stored in ACNUC7421 zone)

EMBL: CP001743.PE630

CP001743.PE630       Location/Qualifiers
FT   CDS_pept        complement(626883..627683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0645"
FT                   /product="tRNA (adenine-N(1)-)-methyltransferase"
FT                   /note="PRIAM: tRNA (adenine-N(1)-)-methyltransferase; PFAM:
FT                   tRNA methyltransferase complex GCD14 subunit;
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase;
FT                   InterPro IPR014816:IPR000682; KEGG: hypothetical protein;
FT                   COGs: COG2519 tRNA(1-methyladenosine) methyltransferase and
FT                   related methyltransferase; SPTR: Q8GBB2 tRNA
FT                   (adenine-N(1)-)-methyltransferase; PFAM:
FT                   Protein-L-isoaspartate(D-aspartate) O-methyltransferase
FT                   (PCMT)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27412"
FT                   /protein_id="ADD27412.1"
FT                   /translation="MTYGDWALLQDRRGRVYLFRLQPGGIFNYHRGSIRHEAIIQAGAG
FT                   RFIATPQGERFSIHRPTLEDYVLQMPREATPTYPKDAATICFLLDLAPGMRVLEAGAGS
FT                   GGLTLYLARAVGPTGQVWSYESRLRHLERARRNLGEYEDWGNVTFVQGDLAQAELPPSS
FT                   FDGVALDLMEPWSVLHSIVPALKIDRFLVCYLPNLTQVVTLLEQIKTLQLPFLHERTLE
FT                   VQHREWDIRPPIAHPKFQQVGHTAFLVQLRRIEHTQQNTLLEVR"
     atgacctacg gcgactgggc cttgctacag gatcgacggg gccgtgtcta tttgtttcga        60
     ttgcaaccgg ggggtatatt caactaccat cggggctcca tccgccatga ggccatcatc       120
     caggccgggg ccggtcggtt tatcgccacc ccccagggtg aacgcttcag catccaccgc       180
     cccaccctgg aagactacgt gctccagatg ccccgcgagg ccacccccac ttaccccaaa       240
     gacgccgcca ccatctgctt tctgctcgac ctggcccctg gcatgcgggt gctggaggca       300
     ggcgcgggct cgggcggcct gaccctgtac ctggcgcgag cggtggggcc caccggccag       360
     gtctggagct acgaatcccg cctccggcac ctcgagcggg ccagacgcaa cctgggcgaa       420
     tatgaggatt ggggcaacgt tacctttgtg cagggcgact tggcccaggc cgagttacca       480
     cccagctcct ttgacggcgt tgccctggat ttgatggaac cctggtcagt gctgcatagc       540
     attgtacccg cgctcaaaat agaccgcttc ctggtctgct atctgcccaa cctgacccag       600
     gtagttacgc tgctcgagca gatcaaaacc ctgcaactgc cgtttttaca cgagcgcacc       660
     ctggaggtgc agcaccggga gtgggacatt cgccccccca tcgcccatcc caagtttcag       720
     caggtggggc atacggcgtt tttggtgcag ctcaggcgga tcgagcacac ccagcaaaac       780
     acgttgctcg aggtcaggta a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page