(data stored in ACNUC7421 zone)

EMBL: CP001743.PE631

CP001743.PE631       Location/Qualifiers
FT   CDS_pept        627986..628492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0646"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: sat:SYN_01761 pilin
FT                   assembly protein; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27413"
FT                   /protein_id="ADD27413.1"
FT                   /translation="MKKATGLSVIELILVVSILGILMVLGGGWFSSDRIRVNQAAQILS
FT                   ADVTRARLEALRRNVPVGIRFDFSSGANFYQIMADVDQNGLDSSDPVINRIQFGAGEYA
FT                   RIVGRLRQCTVADAAAAASAEIVFDARGVYQLATSRTVELSIGSYSRFVNINQQGRAQI
FT                   RTACP"
     gtgaaaaagg cgaccgggct gagcgtaatt gagttgatat tagttgtctc gattctgggc        60
     atcctgatgg tgcttggagg aggatggttt agctcggaca ggatccgggt caatcaggct       120
     gcccagattt taagcgccga cgtaacccgt gcccgcctcg aggcccttcg gcgaaacgtc       180
     ccggtgggaa ttcgcttcga ttttagctct ggggccaact tctatcaaat aatggccgat       240
     gtcgaccaaa atggcttgga tagcagcgac cccgtgatca accgtatcca gtttggagct       300
     ggcgagtacg cccgaattgt aggcaggctg cgtcagtgca cggttgccga tgcggcagcg       360
     gcggccagtg ccgagatcgt tttcgatgcc cgtggggtgt accaactcgc taccagccga       420
     accgtagagt tatccatcgg ctcctatagc cgctttgtca acatcaatca acagggccgt       480
     gcccagattc ggacggcctg tccatag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page