(data stored in ACNUC7421 zone)

EMBL: CP001743.PE632

CP001743.PE632       Location/Qualifiers
FT   CDS_pept        628501..628935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0647"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902:IPR001120; KEGG: vfm:VFMJ11_0359
FT                   MshD; PFAM: Prokaryotic N-terminal methylation motif;
FT                   TIGRFAM: prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27414"
FT                   /protein_id="ADD27414.1"
FT                   /translation="MQNRGITLVELLIALAVLGVAFGVLVFSQVTNYRATARAGVVSQV
FT                   KDTATQILENQVGVVLANFTRYYNGCPTGSETGCYGSGFLINSGIDEGLDGEGQILIQS
FT                   SATSQGITINLATKVSCYDGFASRTAAIGVGSLEPCPRPN"
     atgcaaaaca gaggaatcac cttggtagaa ctcctgatag ccctggccgt gctgggtgtg        60
     gcctttgggg tgttggtgtt ctcgcaggtt accaactacc gcgctaccgc cagggcaggg       120
     gtggtgagcc aggtcaaaga tactgccacg caaattctgg aaaaccaggt aggggtagtg       180
     ttggccaact tcacccgtta ctacaacggc tgccccaccg gtagtgaaac cggctgctat       240
     ggctccggct tcctcatcaa cagcggaatt gatgaaggtc tggatggtga aggacaaatc       300
     ctaatccaat cgtcagcgac cagccagggc atcaccatca acctggcgac aaaagtttcg       360
     tgctacgacg gctttgcttc ccgtacggct gctatcgggg tgggtagcct cgagccctgt       420
     cccaggccca actag                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page