(data stored in ACNUC7421 zone)

EMBL: CP001743.PE637

CP001743.PE637       Location/Qualifiers
FT   CDS_pept        632993..633469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0652"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001120:IPR012902; TIGRFAM: prepilin-type
FT                   N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27419"
FT                   /protein_id="ADD27419.1"
FT                   /translation="MRSRGLTLIEVVVAAGALAIVLGIFTTLLVGNMRQTSIVGGRAQA
FT                   NQLGLFLGRQILEADERAVPDEGESLTWGYGQLTNATSGFPSLTSEQQFANLALYRASV
FT                   TNQGAPSWASSNWQISQYRIEICWRSPEGEQCVNQSIVGPSPAQVGTEINSGIN"
     atgagaagcc gaggactgac ccttattgag gtggtggtgg cggcgggcgc gctggcgatt        60
     gtactgggaa tctttaccac cttgctggtg ggtaacatgc ggcagaccag cattgtaggg       120
     gggcgggccc aggccaatca gctagggctt tttttgggtc ggcagatcct cgaggccgac       180
     gaacgggctg ttccagacga gggtgaaagc ctcacctggg gctatggtca gctcaccaac       240
     gccaccagtg gctttcccag ccttaccagc gagcagcagt tcgccaacct ggccctgtac       300
     cgcgccagtg tcaccaacca gggagcccct tcctgggcca gcagcaactg gcagattagc       360
     cagtaccgca tcgagatctg ctggcgtagt ccggaggggg agcagtgcgt caaccagagc       420
     atcgttggcc cttcgccggc ccaggtggga accgagatta acagcggtat caactaa          477
//

If you have problems or comments...

PBIL Back to PBIL home page