(data stored in ACNUC7421 zone)

EMBL: CP001743.PE638

CP001743.PE638       Location/Qualifiers
FT   CDS_pept        633481..634347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0653"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: lch:Lcho_2930 type IV
FT                   pilus assembly protein; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27420"
FT                   /protein_id="ADD27420.1"
FT                   /translation="MRPRGFTVLELLLALLVLVIVMTLAFNTSIQGLQLNQSNEAVSSA
FT                   QNKARRVLEVLSQDLRTAAFAIVTHTPFNSNATSISFAQVAGGAGYAVSAVAGNSLAIV
FT                   SNSPTIATEIPVGSRLVVIDGNGNAVLTRTTGLPTLSGINTYTIPTTCSNLPVTATSQT
FT                   LASVVSLLGYSYDATNRKLVYQALGDATTTDVAYDVSNFRIDYVYQRRNGSSVSEERNP
FT                   SGYLVSGRAQPYFTSSGSEYTLRRLQFTLGVQLPLRGRNVERTYTGQVDMINNLYYQAK
FT                   VVSICNP"
     ttgcgtcctc gaggtttcac agtcctggaa ttgctgctgg ccctgctggt gctggtgatc        60
     gtgatgacgc tggctttcaa caccagcatc caggggttgc agcttaacca gtccaacgag       120
     gcggtgagct cggcccagaa caaagcccga cgggtgctgg aggtgctgag ccaggatttg       180
     cgcacggcgg ccttcgctat cgtgacccac acccccttca acagcaatgc caccagcatc       240
     tcttttgccc aggtggcggg gggggctggt tacgcggtga gcgctgtggc tggcaacagc       300
     ctggcgattg tgagcaactc ccccaccatc gccaccgaaa ttccggtggg cagccggctg       360
     gttgtgatcg acggcaacgg caacgcagtg ctcacccgta ccaccggact gcccacgctg       420
     agcggtatca atacctacac catccccacc acctgcagca acctgccggt taccgccacc       480
     tcccagaccc tggcctcggt ggttagcttg ctgggctata gctacgatgc aaccaaccgc       540
     aagctggtct accaggccct gggcgatgcg acaacgaccg atgtggccta cgatgtgagc       600
     aatttccgca tcgattacgt ctaccagcgg cgcaatggtt cttcggttag cgaagagcgc       660
     aaccccagcg gctacctggt gagcggccgg gcgcagccct acttcaccag cagcggatcg       720
     gaatatacgt tgcgtcggtt gcagttcacc ctgggggttc agctaccctt gcgcgggcgc       780
     aacgtggagc gaacctacac cgggcaggtg gatatgatca acaacctcta ctatcaggcc       840
     aaggtggtga gcatatgcaa cccatga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page