(data stored in ACNUC7421 zone)

EMBL: CP001743.PE639

CP001743.PE639       Location/Qualifiers
FT   CDS_pept        634335..636248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27421"
FT                   /protein_id="ADD27421.1"
FT                   /translation="MQPMRDRQGIAIVVALTIILLLSVVSTLMFTRSINDLRTSRDNTA
FT                   MAQAINLARGGAVAATALLSNEVRASLESIVQSADPSIGGISTSDIWYYGGNATQPIAS
FT                   TVAARLAVLANTLQTSLNAAICNQNFAPDGSGATVRVRVHFTTAPACGQPFPASAQLPS
FT                   GYVVDDDNNPATPLTRQVQGYALPYVMVVTASPGTPYQRNVMVQGEYRFLLKNGSFARY
FT                   ALFTNRHRTRSNSSVWFTSNTLFDGPVHTNERFNFSFNPWFGGYVTSAGCTNAGASSCA
FT                   GSISPGAFFGAGNNTTFLSPSQMTNPNAPSWTSGGITHAPVFEGNPRVNWQEPFIPMPD
FT                   NNQNQRSAAQTGGLYFNSDIARLTLYAGDDTGTPPTCNASGVCTPATSPYQYIEVCLTT
FT                   ACTGNNRLLYRYDASGALYRYNGSWPGVLVRAGFNGMIFADGSINNLTGPARSDASNPN
FT                   TAPPALASFAQITVANAGSGENIRIQGDLKYQSPACSGTPTRSGNTVTRATCNNLSADN
FT                   ILGVYSQDGDILLGNGTNSSLQDLTIHGVLMTSRGEVAVQNYNSISPRGSIRLQGGIIQ
FT                   YTYGAFGQFNSSTGQMIQGYARQFTYDPRMQDRAPPFFPTTGVVQVSVATPLSFGQREQ
FT                   VY"
     atgcaaccca tgagagatcg ccagggcatc gcgattgtgg tagccctgac cattattctg        60
     ctgttgagcg tggtaagcac cttaatgttc acacgttcca tcaacgactt gcgtaccagc       120
     cgggataaca cggccatggc gcaggccatc aacctggccc ggggcggggc ggtggcggcc       180
     acggccctgc tgtccaacga ggtgcgggcc agcctcgaga gcatcgtgca atcggcagac       240
     cccagcatcg gcggcatcag caccagcgac atctggtact acggcggcaa cgccacccag       300
     cccatcgcct ccacggtggc ggcccgcctg gctgtgctgg ccaacaccct ccagaccagt       360
     cttaatgcgg ccatctgcaa ccagaacttt gcaccggatg gttcgggcgc cacggtgcgg       420
     gtgcgcgtgc actttaccac cgccccggcc tgcggccagc cctttcctgc ttcggcccag       480
     ctaccatccg ggtatgtggt agacgacgac aacaacccag ccacgccctt aacccgccag       540
     gtgcaggggt acgccctgcc ctacgtgatg gtggtcacgg cctctcccgg caccccctac       600
     cagcgcaacg tgatggtgca gggtgagtac cgcttcttgc taaaaaacgg cagctttgct       660
     cgctacgcgc tgtttaccaa ccgacaccgt acccgctcca atagctcggt ctggtttacc       720
     agcaacaccc tgttcgatgg gccggtgcac accaacgagc gctttaactt ctccttcaat       780
     ccctggtttg gcggttatgt gaccagcgcg ggctgcacca atgccggggc cagcagttgt       840
     gctggctcta tcagccctgg tgcgtttttt ggtgcgggca acaacaccac ctttttatcc       900
     cccagtcaga tgaccaaccc caacgccccc tcctggacca gcggtggcat tacccacgcc       960
     ccggtgtttg agggcaaccc ccgggtgaac tggcaggagc cgtttatccc catgccggat      1020
     aacaaccaga accagcgcag cgcggcgcag acggggggtc tatactttaa ctccgacatt      1080
     gcccggctca ccctgtacgc aggggatgac actggaacgc cgcccacctg caacgcttcg      1140
     ggggtttgta cgccggccac ctcgccctac cagtacatcg aggtctgcct gacaacagcc      1200
     tgcacaggga acaaccggct gctataccgc tacgatgcca gcggggcgct ctaccgctac      1260
     aacggaagct ggcccggcgt gctggtgcgg gcgggcttca acggcatgat ctttgccgat      1320
     ggaagcatca acaacctcac cggcccagcc cgttccgatg ccagcaaccc caacaccgcc      1380
     cccccagcgc tggctagttt tgcgcagatt accgtagcca acgctggtag cggtgagaat      1440
     atccgaatcc agggtgacct taagtaccag agcccggcct gcagcggtac gccaacccgg      1500
     agcggcaaca ccgtgacgcg ggccacctgc aataacctct ccgccgacaa tatcctgggg      1560
     gtgtatagcc aggacgggga tattctgctg ggcaacggca ccaacagctc cttgcaggat      1620
     ctgaccattc acggggtgct gatgacatcg aggggcgagg tggcggtgca gaactacaac      1680
     agcatctctc cgcgtggttc catccgcttg caggggggga ttatccagta cacctacggg      1740
     gccttcgggc agttcaacag ctccacaggc cagatgattc agggctatgc tcgccagttc      1800
     acctacgacc cccggatgca agaccgggcc ccgcccttct tcccgaccac cggggtggtg      1860
     caggtgagcg tagccacccc ccttagcttt ggccagcgcg agcaggtgta ctag            1914
//

If you have problems or comments...

PBIL Back to PBIL home page