(data stored in ACNUC7421 zone)

EMBL: CP001743.PE641

CP001743.PE641       Location/Qualifiers
FT   CDS_pept        637033..639138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0656"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR002048; KEGG: oan:Oant_4858 outer
FT                   membrane autotransporter barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27423"
FT                   /protein_id="ADD27423.1"
FT                   /translation="MSDTRGLALVSTLVFMFIVIVLVSIAMLSSLNNRRNAQDALRTSQ
FT                   AQFAAEAGLERAVARLWHQVLASATSRSVTAYGVELDRMGLTNGTTIPSLFGAPQSLGD
FT                   GSSFVVQVSRQDDTRPDPDAIVLTVTSTGTLADGTTRRLRQVFRVDRAYFPFDYALLTN
FT                   NAECIFCHLEVKSLDALRGNPNPNDPSTWWRRAKVGVLESLIMRDDEEAGVVHGPLVAR
FT                   GTISRQYSGAIGPSSRYYTTMRPGDTRIRSATPITTTPADCSTPSNCTTPQNFYYNYPD
FT                   SSSLAAFGNRFPDGELPDRFPLPIPDANHNRLIDDAEWNAEVGSSLAGTNESYSAGTIT
FT                   AAMILNPAGRVAWPGGSAVQTRTSADLGQNPTNVLLDGSVIPIELSGTVFINGDVVLRG
FT                   FVRGNGTLLARGNLYVMGDLTYDCGTGSGLVPCDYSNPSRLPQLNLIAGGNLLVGDFMT
FT                   VQSDIESLSEEQMLSTRSNQPTISFCRENPTDAACYPEERPRPNLALTEIANFNRRELQ
FT                   RYLRDNSYRPRFYTFGEDRIYFATGCSHQPQRYGEYSTIAAGARVSFCRGDTILSSSTL
FT                   TAEQASRILAGAVRYEVTSSSFNNAILKNLWANSMNARGTGPLRTDGLLYSANAIFGLA
FT                   QRKYTKLGGRWDLRGALVAADTGILVPGPGDGSSGLTIYHDSRLRPRVPGGQQAQLRRG
FT                   VWEVVGQ"
     atgtcagata caaggggcct tgcattggtt tcgacgctgg tgtttatgtt cattgttatt        60
     gtgctggtta gcattgctat gctatcctcc ctcaacaacc gtcgcaatgc ccaggatgcc       120
     ctgcgcacct cccaggccca gtttgctgcc gaggcagggc tcgagcgggc cgtggcccgg       180
     ctgtggcacc aggtgctggc cagtgcgacc tcccgtagcg taacggctta tggcgtcgag       240
     ttagaccgga tgggcctgac caacggcacc accataccca gcttgttcgg tgctccacaa       300
     agcctggggg acggctcgag ctttgtggtg caggtctcgc gccaggatga tacccgtccc       360
     gatcccgacg ccatcgtact gaccgtgacc tccaccggta ccctggccga cggcaccacc       420
     cggcgcctgc ggcaggtctt ccgggtagat cgggcctact ttccattcga ctacgccctt       480
     ttgaccaaca acgccgagtg cattttttgc cacctggagg taaaaagcct ggatgcgctg       540
     cggggcaacc ccaaccccaa cgaccccagc acctggtggc ggcgggccaa ggtgggggtg       600
     ctggaaagcc tgattatgcg cgacgatgaa gaagcggggg tggtgcacgg cccgctggtg       660
     gctcgaggca ctatcagccg gcagtacagc ggtgctatcg gcccttccag ccgctactac       720
     accaccatgc gccccggtga tacccgcatt cgctccgcca ctcccatcac aaccaccccg       780
     gccgactgct cgacccccag caactgcacc accccgcaaa acttctacta caactacccc       840
     gatagcagca gtctggcagc gtttggcaac cgcttccccg atggtgagct gcccgatcgt       900
     tttcccctgc ccatcccaga tgccaaccac aaccggctca tcgacgacgc tgagtggaac       960
     gccgaggtgg gctcgagcct ggccggaacc aacgagagct acagcgccgg caccatcacg      1020
     gccgccatga tcctcaaccc cgctggtcgc gtcgcctggc cgggcgggag cgcggtgcag      1080
     acccgaacct cggccgatct gggccagaac cccacgaatg tgctgctgga tggttctgtc      1140
     atcccgattg agctgagcgg tacggtgttc atcaatggag acgtggtgct gaggggattt      1200
     gttcgtggca acggcaccct tctggcccgc ggcaacctct acgtgatggg cgatctgacc      1260
     tacgattgcg gtactgggag tggcctggtt ccctgcgatt acagcaaccc cagccgccta      1320
     ccccagctca acctaatagc gggcggcaat ttgctggtag gcgactttat gaccgttcaa      1380
     agcgacatag aaagcctgag cgaagagcag atgctcagca cccgctccaa ccaacccacc      1440
     atcagcttct gcagagaaaa ccctaccgac gctgcctgct acccggaaga gcgcccgcgg      1500
     cccaacctgg ccctgaccga gatagccaac ttcaaccggc gggagttgca acgctacctg      1560
     cgcgacaata gctaccggcc gcgtttttac acatttggcg aggatcgcat ctacttcgcc      1620
     actggttgca gccatcaacc acaaagatat ggagaataca gcaccattgc agcgggggct      1680
     cgagtctcct tctgccgtgg cgacacgata ctgagcagca gcaccctcac agccgaacaa      1740
     gccagccgca tcctggccgg tgcagtccgc tacgaagtga cctcgagctc cttcaacaac      1800
     gccattctca agaatctctg ggccaactct atgaacgccc ggggtaccgg cccactccgc      1860
     accgatgggc tgctttattc agccaatgct atttttggcc ttgctcaacg caaatatacc      1920
     aagctgggtg ggcgttggga cttgcggggg gccctggtgg ccgccgatac cggcatcttg      1980
     gtgcccggcc ccggggatgg ctcttcgggc ctaaccatct accacgacag ccgcctgcgc      2040
     cctcgagtac cggggggtca gcaggcccag cttagaaggg gcgtgtggga ggtggttggg      2100
     cagtga                                                                 2106
//

If you have problems or comments...

PBIL Back to PBIL home page