(data stored in ACNUC7421 zone)

EMBL: CP001743.PE642

CP001743.PE642       Location/Qualifiers
FT   CDS_pept        639135..639590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0657"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902:IPR001120; KEGG: mms:mma_3359
FT                   type IV pilus assembly related protein; PFAM: Prokaryotic
FT                   N-terminal methylation motif; TIGRFAM: prepilin-type
FT                   N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27424"
FT                   /protein_id="ADD27424.1"
FT                   /translation="MNAPSQKGISLLELLIALAVLGILLGVGLVSLSAYRQSLVIREAA
FT                   TQVATELQSIRQQARRQSLNFSFQAVEGGNTYKAGRTAELASLPSRSLPPGVVFQRVPA
FT                   GGGGVTFLAPYGVVDAANRTFTLRGPGNRVLNVHVVGSTGKVVVRAP"
     gtgaacgcgc cttcacaaaa gggcatcagc ctgctggagc ttttgatcgc gctggccgtg        60
     ctgggcatcc tgctgggggt gggtttggtc tcactgagcg cttaccgaca aagcctggtt       120
     atccgcgagg cggccaccca ggtcgcgacc gagctccaga gcatccgtca acaagcccgc       180
     cggcaatcgc ttaacttttc ctttcaagcg gtggagggtg gcaacaccta caaagcaggc       240
     cgtaccgctg aactggcctc cctgcccagc agatcgctgc ccccaggggt ggttttccag       300
     cgcgtccctg ctggtggggg tggcgttacc ttcctggccc cgtacggcgt ggttgacgcg       360
     gccaaccgca cttttaccct ccgggggccg ggcaaccggg tgctgaatgt gcacgtggtg       420
     ggcagtaccg gcaaggtggt ggtgcgtgcg ccgtaa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page