(data stored in ACNUC7421 zone)

EMBL: CP001743.PE644

CP001743.PE644       Location/Qualifiers
FT   CDS_pept        639962..640777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0659"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001120:IPR012902; TIGRFAM: prepilin-type
FT                   N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27426"
FT                   /protein_id="ADD27426.1"
FT                   /translation="MRKTGFTLIEMLIAAAIGVVILTLIAAGLRSSGDSLRFIQNNQLL
FT                   TEDLRNAGNLISDYLSVAAFVYPPGVTLSIGSAGGYSVRNPRTGDNTWQTGLDPVIALL
FT                   QPPRVENGVEVVKFVMIYPLNRGWVVARATGAENPGSDPANNDKWLLYIYERNLTVGGN
FT                   RLPNGLPATMPTTIPGSSGNLLADYVQPGGFMVSFADCLSFDEEGLAIPVPCPSTAPAP
FT                   LRAEHSAARVRFSLQGEIRQGGRDARVPASPCVSKRLPATCPSGLARLA"
     atgcgcaaga caggctttac cctcatagaa atgctgattg cggccgccat tggggtggtc        60
     attctgactt taattgccgc gggattgcgc agcagcggtg atagcctgcg cttcatacaa       120
     aacaaccaac tccttaccga agacctgcgc aacgctggca acctgataag cgactatctg       180
     tctgtggcgg cttttgtgta ccctcccggc gtgaccctta gcataggcag cgcgggtggc       240
     tatagcgtgc gcaatccgcg caccggcgac aacacctggc agacgggtct ggatccggtg       300
     atagccctgc tccagccccc gcgagtagag aatggggtgg aggtggtgaa attcgtgatg       360
     atctacccgc tcaaccgggg ctgggtggtc gcgcgggcca ccggggccga gaaccccggc       420
     tcagaccctg ccaacaacga caagtggttg ctgtacatct acgaacgcaa cctgacggtg       480
     ggtggcaacc gcctgcccaa tgggctaccg gccaccatgc ccaccaccat accgggcagc       540
     agcggcaacc tgctggccga ctatgtgcag ccgggcggtt ttatggtgag ctttgccgac       600
     tgcctgagct tcgacgagga gggtctggcc atcccggtgc cctgcccttc caccgcacct       660
     gcaccgcttc gggccgagca cagtgcggcg cgggtgcgtt tttcgctgca gggcgagata       720
     aggcaggggg ggcgcgacgc ccgcgtgccg gccagcccct gcgtttcgaa gcggctcccc       780
     gcaacctgcc ccagcggctt agcgagatta gcctga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page