(data stored in ACNUC7421 zone)

EMBL: CP001743.PE646

CP001743.PE646       Location/Qualifiers
FT   CDS_pept        642763..643602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0661"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3;
FT                   ionotropic glutamate receptor; InterPro
FT                   IPR001638:IPR001320; KEGG: mes:Meso_3149 extracellular
FT                   solute-binding protein, family 3; COGs: COG0834 ABC-type
FT                   amino acid transport/signal transduction systems
FT                   periplasmic component/domain; SPTR: A6BRF3 Putative
FT                   cystine-binding periplasmic protein; PFAM: Bacterial
FT                   extracellular solute-binding proteins, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27428"
FT                   /protein_id="ADD27428.1"
FT                   /translation="MKRIGILGLAVLASLGMAQTKIGNCEVTGPKGQFPIRPAVAGQLT
FT                   VQTNLPGPGFWNGDSPATIKDGFEYCLAANIAHRAGLDKVVVQNVAWDALIAGQTRNFD
FT                   FALSQITITEARKRVVDFSRPYFSSDIGVLVRAADKAKFNSPASLKTARLGVQQATTAA
FT                   KFLSETLKHPQNLTRVFPDVAAGFTALRAGQIDAFIIDTSIVLSEAAKSGGALVVVGQF
FT                   STGENYGALFTKGNPNRAQIDKILEALEKDGTLKKLSQTYLAKEWGIDPTTVPLWRP"
     atgaaaagaa tcgggattct aggactggcg gttctggcct cgctggggat ggcccagacc        60
     aaaattggta actgcgaggt caccggtccc aaaggccagt tccccatccg cccggcggtg       120
     gccggccagc ttacggtgca gaccaacctg ccggggccgg gcttctggaa tggcgacagc       180
     cccgccacca tcaaggacgg cttcgagtac tgcctggccg ccaacatcgc ccaccgcgca       240
     gggctggata aagtggtggt gcagaacgtg gcctgggatg ccctgattgc cggccagacc       300
     cgcaacttcg actttgctct ctcacagatc accatcaccg aggcccgcaa gcgggtggtg       360
     gacttctcga ggccctactt ctcctcggat atcggcgtgc tggtgcgggc ggctgataag       420
     gccaaattta actccccggc cagcctcaag accgcccgcc tgggtgtgca gcaggccacc       480
     acggcggcca agttcctgag cgagaccctc aagcaccccc agaacctgac ccgggtcttt       540
     ccggatgtgg cagcgggctt cacggccttg cgggccggtc agatcgatgc cttcatcatc       600
     gacacctcta ttgtgctctc ggaggcggcc aagtcgggtg gggccctggt ggtggtgggt       660
     cagtttagca ccggcgaaaa ttacggtgca ctctttacca aagggaaccc caaccgagcc       720
     cagattgaca agattttgga ggccctggag aaagacggca cgctcaagaa actatcccag       780
     acctacctgg ctaaggaatg ggggattgac cccaccacgg tgccgctctg gcggccctag       840
//

If you have problems or comments...

PBIL Back to PBIL home page