(data stored in ACNUC7421 zone)

EMBL: CP001743.PE65

CP001743.PE65        Location/Qualifiers
FT   CDS_pept        56244..56522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL2508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26847"
FT                   /protein_id="ADD26847.1"
FT                   /translation="MITIHRSGQYRFYVNSGYNLEPPYICVKHEGHVAKFSLQPLALQS
FT                   NNGFSRTELSRIQQAVLDARDQLLKHWANVRGTEGEKPSGELLLHQE"
     atgataacca ttcaccgttc gggacagtat cgcttttacg tcaactcggg ctataacctc        60
     gagcccccct acatctgcgt caagcatgag gggcacgtcg ccaagttttc gctccagccg       120
     ctggccttgc agtccaacaa cggtttttcc cgcaccgagc tgagccgcat ccagcaggcc       180
     gttctggatg cccgcgacca attgctcaaa cactgggcca acgtccgggg caccgagggc       240
     gagaagccca gcggggagct gctcctgcac caggagtga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page