(data stored in ACNUC7421 zone)

EMBL: CP001743.PE655

CP001743.PE655       Location/Qualifiers
FT   CDS_pept        650002..650757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0670"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: A4BH61 Putative uncharacterized protein;
FT                   InterPro IPR013026; KEGG: pol:Bpro_4026 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27437"
FT                   /protein_id="ADD27437.1"
FT                   /translation="MHIRYNPCDFVVGCVPLYREETVRSLVLVLMVLWSLALAQNVAAV
FT                   EKLVDDGKFQEAYEAGLRLGSAEGFVLAARAASYFAGYLAKDNEKADWFGRAEAAARRA
FT                   IQADADNAEAYFELARAQGRLSQYRGILESLGLASSIKENLDKALRLNPRHAGARVALA
FT                   LWHHSLISKNVGWLYGANGNQIMPLFNEAIQLEPQTIIHKVELAGVLAAQGKKEEARKQ
FT                   YEAALAIAPKTAADRFDLERARRELAALR"
     atgcacatcc ggtacaatcc gtgcgacttt gtggtaggtt gtgtgccgtt atacagggag        60
     gaaactgtga ggagtctggt gctggttttg atggtgcttt ggtcgctggc tttggcccag       120
     aacgtcgcag cggttgagaa actggtagac gacggcaagt ttcaggaagc atacgaggcc       180
     ggtttacgtc tgggcagcgc ggagggtttt gtgttggcgg ctagggcggc cagctatttt       240
     gcgggctacc tggccaagga caacgagaaa gccgactggt ttggccgggc cgaagccgcc       300
     gcccgccggg ccatccaggc cgatgccgat aacgccgagg cctattttga gctggctcga       360
     gcccagggcc gcctttcaca gtaccggggc attctggaaa gcctgggcct ggctagcagc       420
     atcaaggaga acctggacaa ggccctgcgc ctgaaccccc gccatgccgg ggccagggtt       480
     gcgctggccc tgtggcacca ttcgctcatc tccaagaacg tgggctggct gtacggggcc       540
     aacggcaacc agattatgcc cctcttcaac gaggccatcc agctcgagcc ccagaccatc       600
     atccacaagg tggagctggc cggggtgctg gcggcccagg gtaagaaaga agaggcccgc       660
     aagcagtacg aggccgcttt ggcgattgcc cccaaaaccg ctgctgatcg cttcgacctc       720
     gagcgggccc ggcgcgagct ggcagccttg cgttga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page