(data stored in ACNUC7421 zone)

EMBL: CP001743.PE656

CP001743.PE656       Location/Qualifiers
FT   CDS_pept        650974..651552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0671"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; SPTR:
FT                   Q3IP23 Putative uncharacterized protein; InterPro
FT                   IPR002790; COGs: COG1432 conserved hypothetical protein;
FT                   KEGG: vsp:VS_II0673 hypothetical protein; PFAM: Protein of
FT                   unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27438"
FT                   /protein_id="ADD27438.1"
FT                   /translation="MNDPFSRIPGWSPQQRVGLFVDTQNLYHSARDYYGQNVNFESLMR
FT                   YAVANRQLVRATAYVVEREHDTSAWPFIYKLSTIGFRVRRMNLTLKETTDEGKPIYEGN
FT                   WDMGIAADMVRLMHTLDVVVLGSGDGDFVDIVEVLMERGIRVEVIAFKETTSQKLIDAV
FT                   DRFIHLPEIENAFVPSKERERTLIPRSEP"
     atgaacgacc cttttagccg tatccccggt tggagccccc agcagcgtgt gggcctgttc        60
     gttgataccc aaaacctcta ccactcggcc cgcgactact acgggcagaa cgtcaacttc       120
     gaaagcctga tgcgctatgc ggtggccaac cgccaactgg tgcgggccac cgcctacgtg       180
     gtcgagcgcg aacacgacac ctcggcctgg cccttcatct acaagctctc caccattggc       240
     ttccgggtgc gccgcatgaa tctgaccctc aaggagacca ccgacgaggg caagcccatc       300
     tacgaaggca actgggatat gggtatcgcc gccgatatgg tgcggctgat gcacaccctg       360
     gacgtggtgg tgctgggcag cggcgacggc gactttgtgg acatcgtgga ggtgctgatg       420
     gaacgcggca tccgggtcga ggtgatcgcc ttcaaggaaa ccacctcgca aaaactgatt       480
     gatgccgtag accgcttcat ccacctgccc gagatcgaga atgctttcgt gcccagcaag       540
     gagcgggagc gcaccctgat accgcgcagc gagccctga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page